Recombinant Human MALT1, GST-tagged
Cat.No. : | MALT1-27H |
Product Overview : | Recombinant Human MALT1(1 a.a. - 813 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene has been found to be recurrently rearranged in chromosomal translocation with two other genes - baculoviral IAP repeat-containing protein 3 (also known as apoptosis inhibitor 2) and immunoglobulin heavy chain locus - in mucosa-associated lymphoid tissue lymphomas. The protein encoded by this gene may play a role in NF-kappaB activation. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. |
Molecular Mass : | 117.5 kDa |
AA Sequence : | MSLLGDPLQALPPSAAPTGPLLAPPAGATLNRLREPLLRRLSELLDQAPEGRGWRRLAELAGSRGRLRLSCLDLE QCSLKVLEPEGSPSLCLLKLMGEKGCTVTELSDFLQAMEHTEVLQLLSPPGIKITVNPESKAVLAGQFVKLCCRA TGHPFVQYQWFKMNKEIPNGNTSELIFNAVHVKDAGFYVCRVNNNFTFEFSQWSQLDVCDIPESFQRSVDGVSES KLQICVEPTSQKLMPGSTLVLQCVAVGSPIPHYQWFKNELPLTHETKKLYMVPYVDLEHQGTYWCHVYNDRDSQD SKKVEIIIDELNNLGHPDNKEQTTDQPLAKDKVALLIGNMNYREHPKLKAPLVDVYELTNLLRQLDFKVVSLLDL TEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLL DMCRKRNDYDDTIPILDALKVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDM GKCHLTKGKQALEIRSSLSEKRALTDPIQGTEYSAESLVRNLQWAKAHELPESMCLKFDCGVQIQLGFAAEFSNV MIIYTSIVYKPPEIIMCDAYVTDFPLDLDIDPKDANKGTPEETGSYLVSKDLPKHCLYTRLSSLQKLKEHLVFTV CLSYQYSGLEDTVEDKQEVNVGKPLIAKLDMHRGLGRKTCFQTCLMSNGPYQSSAATSGGAGHYHSLQDPFHGVY HSHPGNPSNVTPADSCHCSRTPDAFISSFAHHASCHFSRSNVPVETTDEIPFSFSDRLRISEK |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MALT1 MALT1 paracaspase [ Homo sapiens (human) ] |
Official Symbol | MALT1 |
Synonyms | MALT1; mucosa associated lymphoid tissue lymphoma translocation gene 1; MLT; mucosa-associated lymphoid tissue lymphoma translocation protein 1; paracaspase; caspase-like protein; MALT associated translocation; MALT lymphoma-associated translocation; MALT-lymphoma associated translocation; MLT1; DKFZp434L132 |
Gene ID | 10892 |
mRNA Refseq | NM_173844 |
Protein Refseq | NP_776216 |
MIM | 604860 |
UniProt ID | Q9UDY8 |
Chromosome Location | 18q21 |
Pathway | Activation of NF-kappaB in B cells; B cell receptor signaling pathway; BCR signaling pathway |
Function | cysteine-type endopeptidase activity; peptidase activity; protein binding |
◆ Recombinant Proteins | ||
MALT1-27H | Recombinant Human MALT1, GST-tagged | +Inquiry |
MALT1-2551H | Recombinant Human MALT1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MALT1-5308M | Recombinant Mouse MALT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MALT1-9472M | Recombinant Mouse MALT1 Protein | +Inquiry |
MALT1-718H | Recombinant Human MALT1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MALT1-4527HCL | Recombinant Human MALT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MALT1 Products
Required fields are marked with *
My Review for All MALT1 Products
Required fields are marked with *
0
Inquiry Basket