Recombinant Human MAGEA10 protein, His-tagged

• Cat.No.: MAGEA10-3198H
• Product Overview: Recombinant Human MAGEA10 protein(P43363)(1-369aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-369aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 46.3 kDa
• AA Sequence: MPRAPKRQRCMPEEDLQSQSETQGLEGAQAPLAVEEDASSSTSTSSSFPSSFPSSSSSSSSSCYPLIPSTPEEVSADDETPNPPQSAQIACSSPSVVASLPLDQSDEGSSSQKEESPSTLQVLPDSESLPRSEIDEKVTDLVQFLLFKYQMKEPITKAEILESVIRNYEDHFPLLFSEASECMLLVFGIDVKEVDPTGHSFVLVTSLGLTYDGMLSDVQSMPKTGILILILSIVFIEGYCTPEEVIWEALNMMGLYDGMEHLIYGEPRKLLTQDWVQENYLEYRQVPGSDPARYEFLWGPRAHAEIRKMSLLKFLAKVNGSDPRSFPLWYEEALKDEEERAQDRIATTDDTTAMASASSSATGSFSYPE
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: MAGEA10 melanoma antigen family A, 10 [ Homo sapiens ]
• Official Symbol: MAGEA10
• Synonyms: MAGEA10; melanoma antigen family A, 10; MAGE10; melanoma-associated antigen 10; cancer/testis antigen family 1; member 10; CT1.10; MAGE 10 antigen; melanoma associated antigen 10; MGC10599; MAGE-10 antigen; cancer/testis antigen 1.10; cancer/testis antigen family 1, member 10
• Gene ID: 4109
• mRNA Refseq: NM_001011543
• Protein Refseq: NP_001011543
• MIM: 300343
• UniProt ID: P43363