Recombinant Human MAGEA10 Protein (1-369 aa), His-tagged

• Cat.No.: MAGEA10-2231H
• Product Overview: Recombinant Human MAGEA10 Protein (1-369 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cancer. Protein Description: Full Length.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• ProteinLength: 1-369 aa
• Description: Not known, though may play a role in embryonal development and tumor transformation or aspects of tumor progression.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 42.8 kDa
• AA Sequence: MPRAPKRQRCMPEEDLQSQSETQGLEGAQAPLAVEEDASSSTSTSSSFPSSFPSSSSSSSSSCYPLIPSTPEEVSADDETPNPPQSAQIACSSPSVVASLPLDQSDEGSSSQKEESPSTLQVLPDSESLPRSEIDEKVTDLVQFLLFKYQMKEPITKAEILESVIRNYEDHFPLLFSEASECMLLVFGIDVKEVDPTGHSFVLVTSLGLTYDGMLSDVQSMPKTGILILILSIVFIEGYCTPEEVIWEALNMMGLYDGMEHLIYGEPRKLLTQDWVQENYLEYRQVPGSDPARYEFLWGPRAHAEIRKMSLLKFLAKVNGSDPRSFPLWYEEALKDEEERAQDRIATTDDTTAMASASSSATGSFSYPE
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: MAGEA10 melanoma antigen family A, 10 [ Homo sapiens ]
• Official Symbol: MAGEA10
• Synonyms: MAGEA10; MAGE10; member 10; CT1.10; MAGE 10 antigen; MGC10599; MAGE-10 antigen
• Gene ID: 4109
• mRNA Refseq: NM_001011543
• Protein Refseq: NP_001011543
• MIM: 300343
• UniProt ID: P43363