Recombinant Human MAFA
Cat.No. : | MAFA-28859TH |
Product Overview : | Recombinant fragment of Human MAFA (amino acids 222-308) with proprietary tag, predicted MW 35.20 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 87 amino acids |
Description : | MAFA is a transcription factor that binds RIPE3b, a conserved enhancer element that regulates pancreatic beta cell-specific expression of the insulin gene (INS; MIM 176730) (Olbrot et al. |
Molecular Weight : | 35.200kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LEERFSDDQLVSMSVRELNRQLRGFSKEEVIRLKQKRRTLKNRGYAQSRFKRVQQRHILESEKCQLQSQVEQLKLEVGRLAKERDL |
Sequence Similarities : | Belongs to the bZIP family. Maf subfamily.Contains 1 bZIP domain. |
Gene Name | MAFA v-maf musculoaponeurotic fibrosarcoma oncogene homolog A (avian) [ Homo sapiens ] |
Official Symbol | MAFA |
Synonyms | MAFA; v-maf musculoaponeurotic fibrosarcoma oncogene homolog A (avian); transcription factor MafA; hMafA; RIPE3b1; |
Gene ID | 389692 |
mRNA Refseq | NM_201589 |
Protein Refseq | NP_963883 |
MIM | 610303 |
Uniprot ID | Q8NHW3 |
Chromosome Location | 8q24.3 |
Pathway | Developmental Biology, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Insulin Synthesis and Processing, organism-specific biosystem; Maturity onset diabetes of the young, organism-specific biosystem; Maturity onset diabetes of the young, conserved biosystem; |
Function | DNA binding; protein heterodimerization activity; protein homodimerization activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
MAFA-9437M | Recombinant Mouse MAFA Protein | +Inquiry |
MAFA-6582C | Recombinant Chicken MAFA | +Inquiry |
MAFA-28859TH | Recombinant Human MAFA | +Inquiry |
MAFA-5296M | Recombinant Mouse MAFA Protein, His (Fc)-Avi-tagged | +Inquiry |
MAFA-5302Z | Recombinant Zebrafish MAFA | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAFA-4562HCL | Recombinant Human MAFA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MAFA Products
Required fields are marked with *
My Review for All MAFA Products
Required fields are marked with *
0
Inquiry Basket