Recombinant Human MAFA

• Cat.No.: MAFA-28859TH
• Product Overview: Recombinant fragment of Human MAFA (amino acids 222-308) with proprietary tag, predicted MW 35.20 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 87 amino acids
• Description: MAFA is a transcription factor that binds RIPE3b, a conserved enhancer element that regulates pancreatic beta cell-specific expression of the insulin gene (INS; MIM 176730) (Olbrot et al.
• Molecular Weight: 35.200kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: LEERFSDDQLVSMSVRELNRQLRGFSKEEVIRLKQKRRTLKNRGYAQSRFKRVQQRHILESEKCQLQSQVEQLKLEVGRLAKERDL
• Sequence Similarities: Belongs to the bZIP family. Maf subfamily.Contains 1 bZIP domain.

Gene Information

• Gene Name: MAFA v-maf musculoaponeurotic fibrosarcoma oncogene homolog A (avian) [ Homo sapiens ]
• Official Symbol: MAFA
• Synonyms: MAFA; v-maf musculoaponeurotic fibrosarcoma oncogene homolog A (avian); transcription factor MafA; hMafA; RIPE3b1
• Gene ID: 389692
• mRNA Refseq: NM_201589
• Protein Refseq: NP_963883
• MIM: 610303
• Uniprot ID: Q8NHW3
• Chromosome Location: 8q24.3
• Pathway: Developmental Biology, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Insulin Synthesis and Processing, organism-specific biosystem; Maturity onset diabetes of the young, organism-specific biosystem; Maturity onset diabetes of the young, conserved biosystem
• Function: DNA binding; protein heterodimerization activity; protein homodimerization activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity