Recombinant Human Lta Protein

Cat.No. : Lta-070H
Product Overview : Recombinant human Lta protein
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Protein Length : 233
Description : The encoded protein, a member of the tumor necrosis factor family, is a cytokine produced by lymphocytes. The protein is highly inducible, secreted, and forms heterotrimers with lymphotoxin-beta which anchor lymphotoxin-alpha to the cell surface. This protein also mediates a large variety of inflammatory, immunostimulatory, and antiviral responses, is involved in the formation of secondary lymphoid organs during development and plays a role in apoptosis. Genetic variations in this gene are associated with susceptibility to leprosy type 4, myocardial infarction, non-Hodgkin's lymphoma, and psoriatic arthritis. Alternatively spliced transcript variants have been observed for this gene.
Form : lyophilized
AA Sequence : MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Purity : > 98%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : 4°C
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name LTA lymphotoxin alpha (TNF superfamily, member 1) [ Homo sapiens (human) ]
Official Symbol Lta
Synonyms LTA; lymphotoxin alpha (TNF superfamily, member 1); TNFB; lymphotoxin-alpha; LT; TNFSF1; LT-alpha; TNF-beta; tumor necrosis factor beta; tumor necrosis factor ligand superfamily member 1;
Gene ID 4049
mRNA Refseq NM_000595
Protein Refseq NP_000586
MIM 153440
UniProt ID P01374

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Lta Products

Required fields are marked with *

My Review for All Lta Products

Required fields are marked with *

0

Inquiry Basket

cartIcon