Active Recombinant Human Lymphotoxin Alpha (TNF Superfamily, Member 1)

• Cat.No.: LTA-165H
• Product Overview: Recombinant Human lymphotoxin Alpha (TNF Superfamily, Member 1) encoding the human Lymphotoxin alpha (LT-a) protein sequence (containing the signal peptide sequence, and the mature human Lymphotoxin alpha sequence) was expressed in modifiedhuman 293 cells.

Specification

• Cat. No.: LTA-165H
• Description: Lymphotoxin-alpha (LT-a) is a pro-inflammatory cytokine expressed in activated T cells,B cells, natural killer cells, as well as some non-hematopoietic cells. Activation signals include bacterial products, virus infection, T cell receptor activation, crosslinking of surface immunoglobulin (Ig) on B-lymphocytes, and exposure to UV light in epithelial cells. LT-a regulates a variety of biological processes including cell proliferation, apoptosis, coagulation and lipid metabolism.
• Source: Human 293 cells.
• Amino Acid Sequence: LPGVGLTPSAAQTARQHPKMHLAHSNLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL.
• Molecular Mass: Lymphotoxin-alpha migrates as a broad band between 20 and 25 kDa in SDS-PAGE due to post-translation modifications, in particular glycosylation. This compares with the unmodified Lymphotoxin-alpha that has a predicted molecular mass of 18.7kDa.
• pI: Lymphotoxin-alpha separates into a number of isoforms with a pI between 6 and 9 in 2D PAGE due to post-translational modifications, in particular glycosylation. This compares with the unmodified Lymphotoxin-alpha that has a predicted pI of 8.94.
• % Carbohydrate: Purified Lymphotoxin-alpha consists of 0-25% carbohydrate.
• Glycosylation: Lymphotoxin-alpha contains N-linked and possibly O-linked oligosaccharides.
• Purity: >95%, as determined by SDS-PAGE and visualized by Coomassie Brilliant Blue.
• Formulation: When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
• Reconstitution: It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
• Storage: Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
• Activity: The ED50 of Lymphotoxin-alpha is typically 0.05 - 0.07 ng/ml as measured in acytotoxicity assay using the murine WEHI 164 cell line in the presence of actinomycin D.
• Tag: Non

Gene Information

• Gene Name: LTA lymphotoxin alpha (TNF superfamily, member 1) [ Homo sapiens ]
• Synonyms: LTA; lymphotoxin alpha (TNF superfamily, member 1); LT; TNFB; TNFSF1; lymphotoxin alpha; OTTHUMP00000165897; tumor necrosis factor beta; Tumor necrosis factor ligand superfamily member 1; TNF-beta; LT-alpha
• Gene ID: 4049
• mRNA Refseq: NM_000595
• Protein Refseq: NP_000586
• UniProt ID: P01374
• Chromosome Location: 6p21.3
• MIM: 153440
• Pathway: Antigen processing and presentation; Cytokine-cytokine receptor interaction; Type I diabetes mellitus
• Function: cytokine activity; tumor necrosis factor receptor binding