Recombinant Human LTA Full Length protein, His-tagged

Cat.No. : LTA-4367H
Product Overview : Recombinant Human LTA protein(35-205aa), fused with N-terminal His tag, was expressed in HEK293.
Availability April 17, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 35-205aa
Tag : N-His
Form : Liquid in sterile PBS, pH7.4.
Molecular Mass : The protein has a calculated MW of 21 kDa.
Endotoxin : <1.0EU per 1μg (determined by the LAL method).
Purity : > 95 % as determined by SDS-PAGE.
Storage : Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 1.0 mg/ml.
Reconstitution : Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : HHHHHHHHHHLVPRGSRTLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
Gene Name LTA lymphotoxin alpha (TNF superfamily, member 1) [ Homo sapiens ]
Official Symbol LTA
Synonyms LTA; lymphotoxin alpha (TNF superfamily, member 1); TNFB; lymphotoxin-alpha; LT; TNFSF1; LT-alpha; TNF-beta; tumor necrosis factor beta; tumor necrosis factor ligand superfamily member 1;
Gene ID 4049
mRNA Refseq NM_000595
Protein Refseq NP_000586
MIM 153440
UniProt ID P01374

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All LTA Products

Required fields are marked with *

My Review for All LTA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon