Recombinant Human LTA Protein, His/Flag/StrepII-tagged

• Cat.No.: LTA-4599H
• Product Overview: Purified LTA (AAH34729.1 58 a.a. - 205 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.

Specification

• Description: The encoded protein, a member of the tumor necrosis factor family, is a cytokine produced by lymphocytes. The protein is highly inducible, secreted, and forms heterotrimers with lymphotoxin-beta which anchor lymphotoxin-alpha to the cell surface. This protein also mediates a large variety of inflammatory, immunostimulatory, and antiviral responses, is involved in the formation of secondary lymphoid organs during development and plays a role in apoptosis. Genetic variations in this gene are associated with susceptibility to leprosy type 4 and psoriatic arthritis
• Source: Human cells
• Species: Human
• Tag: His&Flag&StrepII
• Form: Liquid
• Bio-activity: Not Tested
• Molecular Mass: 21.56 kDa
• AA Sequence: HSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
• Applications: Western Blot
  Enzyme-linked Immunoabsorbent Assay
  SDS-PAGE
  Protein Interaction
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Concentration: ≥ 10 μg/mL
• Storage Buffer: 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
• Protein length: 58-205 a.a.

Gene Information

• Gene Name: LTA lymphotoxin alpha (TNF superfamily, member 1) [ Homo sapiens ]
• Official Symbol: LTA
• Synonyms: LTA; lymphotoxin alpha (TNF superfamily, member 1); TNFB; lymphotoxin-alpha; LT; TNFSF1; LT-alpha; TNF-beta; tumor necrosis factor beta; tumor necrosis factor ligand superfamily member 1
• Gene ID: 4049
• mRNA Refseq: NM_000595
• Protein Refseq: NP_000586
• MIM: 153440
• UniProt ID: P01374