Recombinant Human LSM3 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: LSM3-808H
• Product Overview: LSM3 MS Standard C13 and N15-labeled recombinant protein (NP_055278) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 11.8 kDa
• AA Sequence: MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVGTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: LSM3 LSM3 homolog, U6 small nuclear RNA and mRNA degradation associated [ Homo sapiens (human) ]
• Official Symbol: LSM3
• Synonyms: LSM3; LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae); U6 snRNA-associated Sm-like protein LSm3; SMX4; USS2; YLR438C
• Gene ID: 27258
• mRNA Refseq: NM_014463
• Protein Refseq: NP_055278
• MIM: 607283
• UniProt ID: P62310