Recombinant Human LSM3 Protein, GST-tagged

Cat.No. : LSM3-4609H
Product Overview : Human LSM3 full-length ORF ( AAH07055, 1 a.a. - 102 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.[supplied by OMIM
Molecular Mass : 36.96 kDa
AA Sequence : MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LSM3 LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae) [ Homo sapiens ]
Official Symbol LSM3
Synonyms LSM3; LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae); U6 snRNA-associated Sm-like protein LSm3; SMX4; USS2; YLR438C;
Gene ID 27258
mRNA Refseq NM_014463
Protein Refseq NP_055278
MIM 607283
UniProt ID P62310

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All LSM3 Products

Required fields are marked with *

My Review for All LSM3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon