Recombinant Human LRP2 Protein (1186-1389 aa), His-tagged
Cat.No. : | LRP2-1448H |
Product Overview : | Recombinant Human LRP2 Protein (1186-1389 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 1186-1389 aa |
Description : | Acts together with cubilin to mediate HDL endocytosis . May participate in regulation of parathyroid-hormone and para-thyroid-hormone-related protein release. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 24.2 kDa |
AA Sequence : | NCTASQFKCASGDKCIGVTNRCDGVFDCSDNSDEAGCPTRPPGMCHSDEFQCQEDGICIPNFWECDGHPDCLYGSDEHNACVPKTCPSSYFHCDNGNCIHRAWLCDRDNDCGDMSDEKDCPTQPFRCPSWQWQCLGHNICVNLSVVCDGIFDCPNGTDESPLCNGNSCSDFNGGCTHECVQEPFGAKCLCPLGFLLANDSKTCE |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | LRP2 low density lipoprotein receptor-related protein 2 [ Homo sapiens ] |
Official Symbol | LRP2 |
Synonyms | LRP2; DBS; gp330; megalin; LRP-2; glycoprotein 330; GP330; |
Gene ID | 4036 |
mRNA Refseq | NM_004525 |
Protein Refseq | NP_004516 |
MIM | 600073 |
UniProt ID | P98164 |
◆ Recombinant Proteins | ||
LRP2-8754H | Recombinant Human LRP2 protein, mFc-tagged | +Inquiry |
LRP2-1448H | Recombinant Human LRP2 Protein (1186-1389 aa), His-tagged | +Inquiry |
LRP2-9234M | Recombinant Mouse LRP2 Protein | +Inquiry |
LRP2-3453R | Recombinant Rat LRP2 Protein | +Inquiry |
LRP2-2811H | Recombinant Human LRP2 protein(4531-4600 aa), C-His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LRP2 Products
Required fields are marked with *
My Review for All LRP2 Products
Required fields are marked with *
0
Inquiry Basket