Recombinant Human LRP2 Protein (1186-1389 aa), His-tagged

• Cat.No.: LRP2-1448H
• Product Overview: Recombinant Human LRP2 Protein (1186-1389 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Partial.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 1186-1389 aa
• Description: Acts together with cubilin to mediate HDL endocytosis . May participate in regulation of parathyroid-hormone and para-thyroid-hormone-related protein release.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 24.2 kDa
• AA Sequence: NCTASQFKCASGDKCIGVTNRCDGVFDCSDNSDEAGCPTRPPGMCHSDEFQCQEDGICIPNFWECDGHPDCLYGSDEHNACVPKTCPSSYFHCDNGNCIHRAWLCDRDNDCGDMSDEKDCPTQPFRCPSWQWQCLGHNICVNLSVVCDGIFDCPNGTDESPLCNGNSCSDFNGGCTHECVQEPFGAKCLCPLGFLLANDSKTCE
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: LRP2 low density lipoprotein receptor-related protein 2 [ Homo sapiens ]
• Official Symbol: LRP2
• Synonyms: LRP2; DBS; gp330; megalin; LRP-2; glycoprotein 330; GP330
• Gene ID: 4036
• mRNA Refseq: NM_004525
• Protein Refseq: NP_004516
• MIM: 600073
• UniProt ID: P98164