Recombinant Human LRP2 protein, mFc-tagged

• Cat.No.: LRP2-8754H
• Product Overview: Recombinant Human LRP2 protein(P98164)(1186-1389aa), fused with C-terminal mFc tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: mFc
• Protein Length: 1186-1389aa
• Tag: C-mFc
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 50.8 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: NCTASQFKCASGDKCIGVTNRCDGVFDCSDNSDEAGCPTRPPGMCHSDEFQCQEDGICIPNFWECDGHPDCLYGSDEHNACVPKTCPSSYFHCDNGNCIHRAWLCDRDNDCGDMSDEKDCPTQPFRCPSWQWQCLGHNICVNLSVVCDGIFDCPNGTDESPLCNGNSCSDFNGGCTHECVQEPFGAKCLCPLGFLLANDSKTCE

Gene Information

• Gene Name: LRP2 low density lipoprotein receptor-related protein 2 [ Homo sapiens ]
• Official Symbol: LRP2
• Synonyms: LRP2; low density lipoprotein receptor-related protein 2; low-density lipoprotein receptor-related protein 2; DBS; gp330; megalin; LRP-2; glycoprotein 330; calcium sensor protein; Heymann nephritis antigen homolog; GP330
• Gene ID: 4036
• mRNA Refseq: NM_004525
• Protein Refseq: NP_004516
• MIM: 600073
• UniProt ID: P98164