Recombinant Human LRP2 protein(4531-4600 aa), C-His-tagged
Cat.No. : | LRP2-2811H |
Product Overview : | Recombinant Human LRP2 protein(P98164)(4531-4600 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 4531-4600 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | SAVKVVQPIQVTVSENVDNKNYGSPINPSEIVPETNPTSPAADGTQVTKWNLFKRKSKQTTNFENPIYAQ |
Gene Name | LRP2 low density lipoprotein receptor-related protein 2 [ Homo sapiens ] |
Official Symbol | LRP2 |
Synonyms | LRP2; low density lipoprotein receptor-related protein 2; low-density lipoprotein receptor-related protein 2; DBS; gp330; megalin; LRP-2; glycoprotein 330; calcium sensor protein; Heymann nephritis antigen homolog; GP330; |
Gene ID | 4036 |
mRNA Refseq | NM_004525 |
Protein Refseq | NP_004516 |
MIM | 600073 |
UniProt ID | P98164 |
◆ Recombinant Proteins | ||
LRP2-27H | Recombinant Human LRP2 Protein, His-tagged | +Inquiry |
LRP2-8754H | Recombinant Human LRP2 protein, mFc-tagged | +Inquiry |
LRP2-7443H | Recombinant Human LRP2 protein, His-tagged | +Inquiry |
LRP2-9234M | Recombinant Mouse LRP2 Protein | +Inquiry |
LRP2-1448H | Recombinant Human LRP2 Protein (1186-1389 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LRP2 Products
Required fields are marked with *
My Review for All LRP2 Products
Required fields are marked with *
0
Inquiry Basket