Recombinant Human LHPP Protein (1-270 aa), His-tagged
Cat.No. : | LHPP-1745H |
Product Overview : | Recombinant Human LHPP Protein (1-270 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Metabolism. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-270 aa |
Description : | Phosphatase that hydrolyzes imidodiphosphate, 3-phosphohistidine and 6-phospholysine. Has broad substrate specificity and can also hydrolyze inorganic diphosphate, but with lower efficiency (By similarity) |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 31.2 kDa |
AA Sequence : | MAPWGKRLAGVRGVLLDISGVLYDSGAGGGTAIAGSVEAVARLKRSRLKVRFCTNESQKSRAELVGQLQRLGFDISEQEVTAPAPAACQILKEQGLRPYLLIHDGVRSEFDQIDTSNPNCVVIADAGESFSYQNMNNAFQVLMELEKPVLISLGKGRYYKETSGLMLDVGPYMKALEYACGIKAEVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVGDVGGAQRCGMRALQVRTGKFRPSDEHHPEVKADGYVDNLAEAVDLLLQHADK |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | LHPP phospholysine phosphohistidine inorganic pyrophosphate phosphatase [ Homo sapiens ] |
Official Symbol | LHPP |
Synonyms | LHPP; HDHD2B; hLHPP; FLJ44846; FLJ46044; MGC117251; MGC142189; MGC142191; |
Gene ID | 64077 |
mRNA Refseq | NM_001167880 |
Protein Refseq | NP_001161352 |
UniProt ID | Q9H008 |
◆ Recombinant Proteins | ||
LHPP-3059R | Recombinant Rat LHPP Protein, His (Fc)-Avi-tagged | +Inquiry |
LHPP-202H | Recombinant Human MMRN2 protein, T7/His-tagged | +Inquiry |
LHPP-1745H | Recombinant Human LHPP Protein (1-270 aa), His-tagged | +Inquiry |
LHPP-28094TH | Recombinant Human LHPP, His-tagged | +Inquiry |
LHPP-1319H | Recombinant Human Phospholysine PhosphoHistidine Inorganic Pyrophosphate Phosphatase, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LHPP-4753HCL | Recombinant Human LHPP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LHPP Products
Required fields are marked with *
My Review for All LHPP Products
Required fields are marked with *
0
Inquiry Basket