Recombinant Human LHPP Protein (1-270 aa), His-tagged

• Cat.No.: LHPP-1745H
• Product Overview: Recombinant Human LHPP Protein (1-270 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Metabolism. Protein Description: Full Length.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• ProteinLength: 1-270 aa
• Description: Phosphatase that hydrolyzes imidodiphosphate, 3-phosphohistidine and 6-phospholysine. Has broad substrate specificity and can also hydrolyze inorganic diphosphate, but with lower efficiency (By similarity)
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 31.2 kDa
• AA Sequence: MAPWGKRLAGVRGVLLDISGVLYDSGAGGGTAIAGSVEAVARLKRSRLKVRFCTNESQKSRAELVGQLQRLGFDISEQEVTAPAPAACQILKEQGLRPYLLIHDGVRSEFDQIDTSNPNCVVIADAGESFSYQNMNNAFQVLMELEKPVLISLGKGRYYKETSGLMLDVGPYMKALEYACGIKAEVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVGDVGGAQRCGMRALQVRTGKFRPSDEHHPEVKADGYVDNLAEAVDLLLQHADK
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: LHPP phospholysine phosphohistidine inorganic pyrophosphate phosphatase [ Homo sapiens ]
• Official Symbol: LHPP
• Synonyms: LHPP; HDHD2B; hLHPP; FLJ44846; FLJ46044; MGC117251; MGC142189; MGC142191
• Gene ID: 64077
• mRNA Refseq: NM_001167880
• Protein Refseq: NP_001161352
• UniProt ID: Q9H008