Recombinant Human LGALS14, His-tagged

Description :	This gene is predominantly expressed in placenta. The encoded protein belongs to the galectin (galaptin/S-lectin) family. The members of galectin family contain one or two carbohydrate recognition domains, which can bind beta-galactoside. Two alternatively spliced transcript variants encoding distinct isoforms have been observed.
Protein length :	139 amino acids
Conjugation :	HIS
Molecular Weight :	18.500kDa
Source :	E. coli
Tissue specificity :	Highly expressed in placenta.
Form :	Liquid
Purity :	>90% by SDS-PAGE
Storage buffer :	Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage :	Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids :	MGSSHHHHHHSSGLVPRGSHMGSMSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDIAFQFRLHFGHPAIMNSRVFGIWRYEEKCYYLPFEDGKPFELCIYVRHKEYKVMVNGQRIYNFAHRFPPASVKMLQVLRDISLTRVLISD
Sequence Similarities :	Contains 1 galectin domain.

Gene Name	LGALS14 lectin, galactoside-binding, soluble, 14 [ Homo sapiens ]
Official Symbol	LGALS14
Synonyms	LGALS14; lectin, galactoside-binding, soluble, 14; placental protein 13-like; CLC2; PPL13;
Gene ID	56891
mRNA Refseq	NM_203471
Protein Refseq	NP_982297
MIM	607260
Uniprot ID	Q8TCE9
Chromosome Location	19q13
Function	sugar binding;