Recombinant Human LGALS14, His-tagged

• Cat.No.: LGALS14-26800TH
• Product Overview: Recombinant full length Human LGALS14 with an N terminal His tag ; Predicted MWt: 18.5 kDa

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 139 amino acids
• Description: This gene is predominantly expressed in placenta. The encoded protein belongs to the galectin (galaptin/S-lectin) family. The members of galectin family contain one or two carbohydrate recognition domains, which can bind beta-galactoside. Two alternatively spliced transcript variants encoding distinct isoforms have been observed.
• Conjugation: HIS
• Molecular Weight: 18.500kDa
• Tissue specificity: Highly expressed in placenta.
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGSMSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDIAFQFRLHFGHPAIMNSRVFGIWRYEEKCYYLPFEDGKPFELCIYVRHKEYKVMVNGQRIYNFAHRFPPASVKMLQVLRDISLTRVLISD
• Sequence Similarities: Contains 1 galectin domain.

Gene Information

• Gene Name: LGALS14 lectin, galactoside-binding, soluble, 14 [ Homo sapiens ]
• Official Symbol: LGALS14
• Synonyms: LGALS14; lectin, galactoside-binding, soluble, 14; placental protein 13-like; CLC2; PPL13
• Gene ID: 56891
• mRNA Refseq: NM_203471
• Protein Refseq: NP_982297
• MIM: 607260
• Uniprot ID: Q8TCE9
• Chromosome Location: 19q13
• Function: sugar binding