Recombinant Human LGALS14 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: LGALS14-3865H
• Product Overview: LGALS14 MS Standard C13 and N15-labeled recombinant protein (NP_064514) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene is predominantly expressed in placenta. The encoded protein belongs to the galectin (galaptin/S-lectin) family. The members of galectin family contain one or two carbohydrate recognition domains, which can bind beta-galactoside. Two alternatively spliced transcript variants encoding distinct isoforms have been observed.
• Molecular Mass: 16.1 kDa
• AA Sequence: MSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDIAFQFRLHFGHPAIMNSRVFGIWRYEEKCYYLPFEDGKPFELCIYVRHKEYKVMVNGQRIYNFAHRFPPASVKMLQVLRDISLTRVLISDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: LGALS14 galectin 14 [ Homo sapiens (human) ]
• Official Symbol: LGALS14
• Synonyms: LGALS14; lectin, galactoside-binding, soluble, 14; placental protein 13-like; CLC2; PPL13; gal-14; galectin-14; Charcot-Leyden crystal protein 2; placental protein 13-like protein; MGC22235
• Gene ID: 56891
• mRNA Refseq: NM_020129
• Protein Refseq: NP_064514
• MIM: 607260
• UniProt ID: Q8TCE9