Recombinant Human LCN1

• Cat.No.: LCN1-29847TH
• Product Overview: Recombinant fragment: SDEEIQDVSG TWYLKAMTVD REFPEMNLES VTPMTLTTLE GGNLEAKVTM LISGRCQEVK AVLEKTDEPG KYTADGGKHV AYIIRSHVKD HYIFYCE of Human LCN1 (amino acids 24-120) with N terminal proprietary tag, 36.3 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 97 amino acids
• Description: The protein encoded by this gene belongs to the lipocalin family. Lipocalins are a group of extracellular proteins that are able to bind lipophiles by enclosure within their structures to minimize solvent contact. This protein may bind hydrophobic ligands and inhibit cysteine proteinases. It may also play a role in taste reception.
• Molecular Weight: 36.300kDa inclusive of tags
• Tissue specificity: Mainly expressed in lachrymal and salivary glands. Also expressed in the prostate.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: SDEEIQDVSGTWYLKAMTVDREFPEMNLESVTPMTLTTLEGGNLEAKVTMLISGRCQEVKAVLEKTDEPGKYTADGGKHVAYIIRSHVKDHYIFYCE
• Sequence Similarities: Belongs to the calycin superfamily. Lipocalin family.

Gene Information

• Gene Name: LCN1 lipocalin 1 [ Homo sapiens ]
• Official Symbol: LCN1
• Synonyms: LCN1; lipocalin 1; lipocalin 1 (protein migrating faster than albumin, tear prealbumin) , lipocalin 1 (tear prealbumin); lipocalin-1; lipocalin 1 like 2; MGC71975; PMFA; tear lipocalin; tear prealbumin; TP; VEGP; Von Ebner gland protein
• Gene ID: 3933
• mRNA Refseq: NM_002297
• Protein Refseq: NP_002288
• MIM: 151675
• Uniprot ID: P31025
• Chromosome Location: 9q34
• Function: binding; cysteine-type endopeptidase inhibitor activity; transporter activity