Recombinant Human LCN1
Cat.No. : | LCN1-29220TH |
Product Overview : | Recombinant full length Human LCN1 (amino acids 1-176) with N terminal proprietary tag, 45.43 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 176 amino acids |
Description : | The protein encoded by this gene belongs to the lipocalin family. Lipocalins are a group of extracellular proteins that are able to bind lipophiles by enclosure within their structures to minimize solvent contact. This protein may bind hydrophobic ligands and inhibit cysteine proteinases. It may also play a role in taste reception. |
Molecular Weight : | 45.430kDa inclusive of tags |
Tissue specificity : | Mainly expressed in lachrymal and salivary glands. Also expressed in the prostate. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MKPLLLAVSLGLIAALQAHHLLASDEEIQDVSGTWYLKAM TVDREFPEMNLESVTPMTLTTLEGGNLEAKVTMLISGRCQ EVKAVLEKTDEPGKYTADGGKHVAYIIRSHVKDHYIFYCE GELHGKPVRGVKLVGRDPKNNLEALEDFEKAAGARGLSTE SILIPRQSETCSPGSD |
Sequence Similarities : | Belongs to the calycin superfamily. Lipocalin family. |
Gene Name | LCN1 lipocalin 1 [ Homo sapiens ] |
Official Symbol | LCN1 |
Synonyms | LCN1; lipocalin 1; lipocalin 1 (protein migrating faster than albumin, tear prealbumin) , lipocalin 1 (tear prealbumin); lipocalin-1; lipocalin 1 like 2; MGC71975; PMFA; tear lipocalin; tear prealbumin; TP; VEGP; Von Ebner gland protein; |
Gene ID | 3933 |
mRNA Refseq | NM_002297 |
Protein Refseq | NP_002288 |
MIM | 151675 |
Uniprot ID | P31025 |
Chromosome Location | 9q34 |
Function | binding; cysteine-type endopeptidase inhibitor activity; transporter activity; |
◆ Recombinant Proteins | ||
Lcn1-1826R | Recombinant Rat Lcn1 protein, His & T7-tagged | +Inquiry |
LCN1-29220TH | Recombinant Human LCN1 | +Inquiry |
LCN1-2719H | Recombinant Human LCN1 protein(31-100 aa), C-His-tagged | +Inquiry |
LCN1-337H | Recombinant Human LCN1 Protein, MYC/DDK-tagged | +Inquiry |
LCN1-593H | Recombinant Human lipocalin 1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LCN1-2211HCL | Recombinant Human LCN1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LCN1 Products
Required fields are marked with *
My Review for All LCN1 Products
Required fields are marked with *
0
Inquiry Basket