Recombinant Human LCN1

Description :	The protein encoded by this gene belongs to the lipocalin family. Lipocalins are a group of extracellular proteins that are able to bind lipophiles by enclosure within their structures to minimize solvent contact. This protein may bind hydrophobic ligands and inhibit cysteine proteinases. It may also play a role in taste reception.
Protein length :	176 amino acids
Molecular Weight :	45.430kDa inclusive of tags
Source :	Wheat germ
Tissue specificity :	Mainly expressed in lachrymal and salivary glands. Also expressed in the prostate.
Form :	Liquid
Purity :	Proprietary Purification
Storage buffer :	pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage :	Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids :	MKPLLLAVSLGLIAALQAHHLLASDEEIQDVSGTWYLKAM TVDREFPEMNLESVTPMTLTTLEGGNLEAKVTMLISGRCQ EVKAVLEKTDEPGKYTADGGKHVAYIIRSHVKDHYIFYCE GELHGKPVRGVKLVGRDPKNNLEALEDFEKAAGARGLSTE SILIPRQSETCSPGSD
Sequence Similarities :	Belongs to the calycin superfamily. Lipocalin family.
Tag :	Non

Gene Name	LCN1 lipocalin 1 [ Homo sapiens ]
Official Symbol	LCN1
Synonyms	LCN1; lipocalin 1; lipocalin 1 (protein migrating faster than albumin, tear prealbumin) , lipocalin 1 (tear prealbumin); lipocalin-1; lipocalin 1 like 2; MGC71975; PMFA; tear lipocalin; tear prealbumin; TP; VEGP; Von Ebner gland protein;
Gene ID	3933
mRNA Refseq	NM_002297
Protein Refseq	NP_002288
MIM	151675
Uniprot ID	P31025
Chromosome Location	9q34
Function	binding; cysteine-type endopeptidase inhibitor activity; transporter activity;