Recombinant Full Length Human LCN1 Protein Protein

• Cat.No.: LCN1-277HF
• Product Overview: Recombinant full length Human LCN1 (amino acids 1-176) with N terminal proprietary tag, 45.43 kDa.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 176 amino acids
• Description: The protein encoded by this gene belongs to the lipocalin family. Lipocalins are a group of extracellular proteins that are able to bind lipophiles by enclosure within their structures to minimize solvent contact. This protein may bind hydrophobic ligands and inhibit cysteine proteinases. It may also play a role in taste reception.
• Form: Liquid
• Molecular Mass: 45.430kDa inclusive of tags
• AA Sequence: MKPLLLAVSLGLIAALQAHHLLASDEEIQDVSGTWYLKAM TVDREFPEMNLESVTPMTLTTLEGGNLEAKVTMLISGRCQ EVKAVLEKTDEPGKYTADGGKHVAYIIRSHVKDHYIFYCE GELHGKPVRGVKLVGRDPKNNLEALEDFEKAAGARGLSTE SILIPRQSETCSPGSD
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: LCN1 lipocalin 1 [ Homo sapiens ]
• Official Symbol: LCN1
• Synonyms: LCN1; lipocalin 1; lipocalin 1 (protein migrating faster than albumin, tear prealbumin) , lipocalin 1 (tear prealbumin); lipocalin-1; lipocalin 1 like 2; MGC71975; PMFA; tear lipocalin; tear prealbumin; TP; VEGP; Von Ebner gland protein
• Gene ID: 3933
• mRNA Refseq: NM_002297
• Protein Refseq: NP_002288
• MIM: 151675
• UniProt ID: P31025