Recombinant Human LATS2 protein, GST-tagged
Cat.No. : | LATS2-301645H |
Product Overview : | Recombinant Human LATS2 (140-424 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met140-Pro424 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MGYLDPRNEQIVRVIKQTSPGKGLMPTPVTRRPSFEGTGDSFASYHQLSGTPYEGPSFGADGPTALEEMPRPYVDYLFPGVGPHGPGHQHQHPPKGYGASVEAAGAHFPLQGAHYGRPHLLVPGEPLGYGVQRSPSFQSKTPPETGGYASLPTKGQGGPPGAGLAFPPPAAGLYVPHPHHKQAGPAAHQLHVLGSRSQVFASDSPPQSLLTPSRNSLNVDLYELGSTSVQQWPAATLARRDSLQKPGLEAPPRAHVAFRPDCPVPSRTNSFNSHQPRPGPPGKAEP |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | LATS2 LATS, large tumor suppressor, homolog 2 (Drosophila) [ Homo sapiens ] |
Official Symbol | LATS2 |
Synonyms | LATS2; LATS, large tumor suppressor, homolog 2 (Drosophila); LATS (large tumor suppressor, Drosophila) homolog 2; serine/threonine-protein kinase LATS2; warts-like kinase; serine/threonine kinase KPM; large tumor suppressor homolog 2; serine/threonine-protein kinase kpm; kinase phosphorylated during mitosis protein; KPM; FLJ13161; |
Gene ID | 26524 |
mRNA Refseq | NM_014572 |
Protein Refseq | NP_055387 |
MIM | 604861 |
UniProt ID | Q9NRM7 |
◆ Recombinant Proteins | ||
LATS2-6821Z | Recombinant Zebrafish LATS2 | +Inquiry |
LATS2-28502TH | Recombinant Human LATS2 | +Inquiry |
LATS2-301645H | Recombinant Human LATS2 protein, GST-tagged | +Inquiry |
LATS2-381H | Recombinant Human LATS2, GST-tagged | +Inquiry |
LATS2-6686Z | Recombinant Zebrafish LATS2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
LATS2-4813HCL | Recombinant Human LATS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LATS2 Products
Required fields are marked with *
My Review for All LATS2 Products
Required fields are marked with *
0
Inquiry Basket