Recombinant Human KRTAP10-2 Protein, GST-tagged

• Cat.No.: KRTAP10-2-4828H
• Product Overview: Human KRTAP10-2 full-length ORF ( AAI46566.1, 1 a.a. - 255 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• ProteinLength: 1-255 a.a.
• Description: This gene encodes a member of the keratin-associated protein (KAP) family. The KAP proteins form a matrix of keratin intermediate filaments which contribute to the structure of hair fibers. KAP family members appear to have unique, family-specific amino- and carboxyl-terminal regions and are subdivided into three multi-gene families according to amino acid composition: the high sulfur, the ultrahigh sulfur, and the high tyrosine/glycine KAPs. This gene encodes a member of the high sulfur KAP family. It is localized to a cluster of intronless KAPs at 21q22.3 which are located within the introns of the C21orf29 gene. [provided by RefSeq
• Molecular Mass: 55 kDa
• AA Sequence: MAASTMSICSSACTNSWQVDDCPESCCELPCGTPSCCAPAPCLTLVCTPVSCVSSPCCQAACEPSACQSGCTSSCTPSCCQQSSCQPACCTSSPCQQACCVPVCCKPVCCVPVCCGASSCCQQSSCQPACCASSSCQQSCRVPVCCKAVCCVPTCSESSSSCCQQSSCQPACCTSSPCQQSCCVSVCCKPVCCKSICCVPVCSGASSPCCQQSSCQPACCTSSCCRPSSSVSLLCRPVCSRPASCSFSSGQKSSC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: KRTAP10-2 keratin associated protein 10-2 [ Homo sapiens (human) ]
• Official Symbol: KRTAP10-2
• Synonyms: KRTAP10-2; keratin associated protein 10-2; KAP10.2; KAP18-2; KAP18.2; KRTAP10.2; KRTAP18-2; KRTAP18.2; keratin-associated protein 10-2; high sulfur keratin-associated protein 10.2; keratin-associated protein 18-2; keratin-associated protein 18.2
• Gene ID: 386679
• mRNA Refseq: NM_198693
• Protein Refseq: NP_941966
• UniProt ID: P60368