Recombinant Human KLK3 protein

• Cat.No.: KLK3-89H
• Product Overview: Recombinant Human KLK3 protein was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 237
• Description: The human tissue kallikrein (KLK) gene family contains 15 members that play important roles in cancer. Kallikrein-3, called prostate specific antigen (PSA), is a glycoprotein enzyme encoded in humans by the KLK3 gene. PSA is secreted by the epithelial cells of the prostate gland, hydrolyzes semenogelin-1 thus leading to the liquefaction of the seminal coagulum. PSA is an established tumor marker that aids in the diagnosis, staging, and follow up of prostate cancer.
• Form: Lyophilized from a 0.2 μm filtered concentrated solution in 20mM Tris-HCl, pH 8.0, 150mM NaCl, 3% trehalose.
• Molecular Mass: Approximately 26.1 kDa, a single non-glycosylated polypeptide chain containing 237 amino acids.
• AA Sequence: IVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP
• Endotoxin: Less than 0.1 EU/μg of rHuPSA/Kallikrein-3 as determined by LAL method.
• Purity: >95% by SDS-PAGE and HPLC analyses.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: KLK3
• Official Symbol: KLK3
• Synonyms: KLK3; kallikrein-related peptidase 3; APS, kallikrein 3, (prostate specific antigen); prostate-specific antigen; PSA; seminin; P-30 antigen; kallikrein-3; semenogelase; gamma-seminoprotein; prostate specific antigen; APS; hK3; KLK2A1
• Gene ID: 354
• mRNA Refseq: NM_001030047
• Protein Refseq: NP_001025218
• MIM: 176820
• UniProt ID: P07288