Recombinant Full Length Human KLK3 Protein, GST-tagged
Cat.No. : | KLK3-5854HF |
Product Overview : | Human KLK3 full-length ORF ( AAH05307, 1 a.a. - 261 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 261 amino acids |
Description : | Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Its protein product is a protease present in seminal plasma. It is thought to function normally in the liquefaction of seminal coagulum, presumably by hydrolysis of the high molecular mass seminal vesicle protein. Serum level of this protein, called PSA in the clinical setting, is useful in the diagnosis and monitoring of prostatic carcinoma. Alternate splicing of this gene generates several transcript variants encoding different isoforms. [provided by RefSeq |
Molecular Mass : | 54.45 kDa |
AA Sequence : | MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDVSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKLMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | KLK3 kallikrein-related peptidase 3 [ Homo sapiens ] |
Official Symbol | KLK3 |
Synonyms | KLK3; kallikrein-related peptidase 3; APS, kallikrein 3, (prostate specific antigen); prostate-specific antigen; PSA; seminin; P-30 antigen; kallikrein-3; semenogelase; gamma-seminoprotein; prostate specific antigen; APS; hK3; KLK2A1; |
Gene ID | 354 |
mRNA Refseq | NM_001030047 |
Protein Refseq | NP_001025218 |
MIM | 176820 |
UniProt ID | P07288 |
◆ Recombinant Proteins | ||
KLK3-01H | Active Recombinant Human KLK3 Protein (18-261aa), C-His tagged | +Inquiry |
KLK3-1258H | Recombinant Human KLK3 Protein, His (Fc)-Avi-tagged | +Inquiry |
KLK3-6969H | Active Recombinant Human KLK3 protein, His-tagged | +Inquiry |
KLK3-2374H | Recombinant Human KLK3 Protein, His-tagged | +Inquiry |
KLK3-4937H | Recombinant Human KLK3 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
KLK3-387H | Native Human Prostate Specific Antigen (PSA), Low pI Isoform (IEF) | +Inquiry |
KLK3-385H | Native Human Prostate Specific Antigen (PSA), High pI Isoform (IEF) | +Inquiry |
KLK3-8248H | Native Human Prostate Specific Antigen | +Inquiry |
KLK3-386H | Native Human Prostate Specific Antigen | +Inquiry |
KLK3-8247H | Native Human Prostate Specific Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLK3-1832HCL | Recombinant Human KLK3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KLK3 Products
Required fields are marked with *
My Review for All KLK3 Products
Required fields are marked with *
0
Inquiry Basket