Recombinant Human KLK12 protein(18-248aa), His&Myc-tagged

• Cat.No.: KLK12-7648H
• Product Overview: Recombinant Human KLK12 protein(Q9UKR0)(18-248aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: N-His&C-Myc
• ProteinLength: 18-248aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 32.4 kDa
• AASequence: ATPKIFNGTECGRNSQPWQVGLFEGTSLRCGGVLIDHRWVLTAAHCSGSRYWVRLGEHSLSQLDWTEQIRHSGFSVTHPGYLGASTSHEHDLRLLRLRLPVRVTSSVQPLPLPNDCATAGTECHVSGWGITNHPRNPFPDLLQCLNLSIVSHATCHGVYPGRITSNMVCAGGVPGQDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQDGIPGVYTYICKYVDWIRMIMRNN
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: KLK12 kallikrein-related peptidase 12 [ Homo sapiens ]
• Official Symbol: KLK12
• Synonyms: KLK12; kallikrein-related peptidase 12; kallikrein 12; kallikrein-12; KLK L5; kallikrein-like protein 5; KLKL5; KLK-L5; MGC42603; DKFZp686H1078
• Gene ID: 43849
• mRNA Refseq: NM_019598
• Protein Refseq: NP_062544
• MIM: 605539
• UniProt ID: Q9UKR0