Recombinant Human KLF6

• Cat.No.: KLF6-29903TH
• Product Overview: Recombinant fragment corresponding to amino acids 1-261 of Human KLF6 with a N terminal proprietary tag; predicted MWt 54.71 kDa inclusive of tag. AAH04301

Specification

• Description: This gene encodes a member of the Kruppel-like family of transcription factors. The zinc finger protein is a transcriptional activator, and functions as a tumor suppressor. Multiple transcript variants encoding different isoforms have been found for this gene, some of which are implicated in carcinogenesis.
• Protein length: 261 amino acids
• Molecular Weight: 54.710kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Highly expressed in placenta followed by spleen, thymus, prostate, testis, small intestine and colon. Weakly expressed in pancreas, lung, liver, heart and skeletal muscle. Also expressed in fetal brain, spleen and thymus.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MDVLPMCSIFQELQIVHETGYFSALPSLEEYWQQTCLELE RYLQSEPCYVSASEIKFDSQEDLWTKIILAREKKEESELK ISSSPPEDTLISPSFCYNLETNSLNSDVSSESSDSSEELS PTAKFTSDPIGEVLVSSGKLGSSVTSAPPSSPELSREPSQ LWGCVPGELPSPGKVRSGTSGKPGDKGNGDASPDGRRRVH RCHFNGCRKVYTKSSHLKAHQRTHTGEKPYRCSWEGCEWR FARSDELTRHFRKHTGAKPF
• Sequence Similarities: Belongs to the krueppel C2H2-type zinc-finger protein family.Contains 3 C2H2-type zinc fingers.
• Tag: Non

Gene Information

• Gene Name: KLF6 Kruppel-like factor 6 [ Homo sapiens ]
• Official Symbol: KLF6
• Synonyms: KLF6; Kruppel-like factor 6; BCD1, COPEB, core promoter element binding protein , ST12; Krueppel-like factor 6; CPBP; GBF; GC rich binding factor; PAC1; Zf9
• Gene ID: 1316
• mRNA Refseq: NM_001160124
• Protein Refseq: NP_001153596
• MIM: 602053
• Uniprot ID: Q99612
• Chromosome Location: 10p15
• Pathway: Adipogenesis, organism-specific biosystem
• Function: DNA binding; double-stranded DNA binding; metal ion binding; sequence-specific DNA binding transcription factor activity; zinc ion binding