Recombinant Human KLF6 protein, GST-tagged

• Cat.No.: KLF6-1865H
• Product Overview: Recombinant Human KLF6 protein(1-283 aa), fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• Protein length: 1-283 aa
• AA Sequence: MDVLPMCSIFQELQIVHETGYFSALPSLEEYWQQTCLELERYLQSEPCYVSASEIKFDSQEDLWTKIILAREKKEESELKISSSPPEDTLISPSFCYNLETNSLNSDVSSESSDSSEELSPTAKFTSDPIGEVLVSSGKLSSSVTSTPPSSPELSREPSQLWGCVPGELPSPGKVRSGTSGKPGDKGNGDASPDGRRRVHRCHFNGCRKVYTKSSHLKAHQRTHTGEKPYRCSWEGCEWRFARSDELTRHFRKHTGAKPFKCSHCDRCFSRSDHLALHMKRHL
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: KLF6 Kruppel-like factor 6 [ Homo sapiens ]
• Official Symbol: KLF6
• Synonyms: KLF6; Kruppel-like factor 6; BCD1, COPEB, core promoter element binding protein , ST12; Krueppel-like factor 6; CPBP; GBF; GC rich binding factor; PAC1; Zf9; proto-oncogene BCD1; GC-rich binding factor; B-cell-derived protein 1; transcription factor Zf9; protooncogene B-cell derived 1; GC-rich sites-binding factor GBF; Kruppel-like zinc finger protein Zf9; core promoter element binding protein; core promoter element-binding protein; suppressor of tumorigenicity 12 protein; suppression of tumorigenicity 12 (prostate); ZF9; BCD1; CBA1; ST12; COPEB; DKFZp686N0199
• Gene ID: 1316
• mRNA Refseq: NM_001160124
• Protein Refseq: NP_001153596
• MIM: 602053
• UniProt ID: Q99612