Recombinant Human KLF6 protein, GST-tagged

Cat.No. : KLF6-1865H
Product Overview : Recombinant Human KLF6 protein(1-283 aa), fused to GST tag, was expressed in E. coli.
Availability April 17, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-283 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : MDVLPMCSIFQELQIVHETGYFSALPSLEEYWQQTCLELERYLQSEPCYVSASEIKFDSQEDLWTKIILAREKKEESELKISSSPPEDTLISPSFCYNLETNSLNSDVSSESSDSSEELSPTAKFTSDPIGEVLVSSGKLSSSVTSTPPSSPELSREPSQLWGCVPGELPSPGKVRSGTSGKPGDKGNGDASPDGRRRVHRCHFNGCRKVYTKSSHLKAHQRTHTGEKPYRCSWEGCEWRFARSDELTRHFRKHTGAKPFKCSHCDRCFSRSDHLALHMKRHL
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name KLF6 Kruppel-like factor 6 [ Homo sapiens ]
Official Symbol KLF6
Synonyms KLF6; Kruppel-like factor 6; BCD1, COPEB, core promoter element binding protein , ST12; Krueppel-like factor 6; CPBP; GBF; GC rich binding factor; PAC1; Zf9; proto-oncogene BCD1; GC-rich binding factor; B-cell-derived protein 1; transcription factor Zf9; protooncogene B-cell derived 1; GC-rich sites-binding factor GBF; Kruppel-like zinc finger protein Zf9; core promoter element binding protein; core promoter element-binding protein; suppressor of tumorigenicity 12 protein; suppression of tumorigenicity 12 (prostate); ZF9; BCD1; CBA1; ST12; COPEB; DKFZp686N0199;
Gene ID 1316
mRNA Refseq NM_001160124
Protein Refseq NP_001153596
MIM 602053
UniProt ID Q99612

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All KLF6 Products

Required fields are marked with *

My Review for All KLF6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon