Recombinant Human KIR3DL2 Protein, C-His-tagged

• Cat.No.: KIR3DL2-085H
• Product Overview: Recombinant Human KIR3DL2 Protein with C-His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: The killer immunoglobulin-like receptors (KIRs) on natural killer (NK) cells regulate the inhibition and activation of NK-cell responses through recognition of human leukocyte antigen (HLA) class I molecules. KIR3DL1, a receptor for HLA-B antigens with the Bw4 allele, transmits an inhibitory signal to prevent killer cell-mediated cytoxicity. KIR3DL1 encodes a 444 amino acid type I transmembrane protein, containing 3 immunoglobulin-like C2-type domains. Human KIR3DL1 maps to chromosome 19q13.4.
• Molecular Mass: ~35 kDa
• AA Sequence: LMGGQDKPFLSARPSTVVPRGGHVALQCHYRRGFNNFMLYKEDRSHVPIFHGRIFQESFIMGPVTPAHAGTYRCRGSRPHSLTGWSAPSNPLVIMVTGNHRKPSLLAHPGPLLKSGETVILQCWSDVMFEHFFLHREGISEDPSRLVGQIHDGVSKANFSIGPLMPVLAGTYRCYGSVPHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVQAGENVTLSCSSWSSYDIYHLSREGEAHERRLRAVPKVNRTFQADFPLGPATHGGTYRCFGSFRALPCVWSNSSDPLLVSVTGNPSSSWPSPTEPSSKSGICRHLH
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
• Notes: For research use only, not for use in diagnostic procedure.
• Storage: Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
• Concentration: ≥0.5 mg/mL
• Storage Buffer: PBS, 4M Urea, pH7.4

Gene Information

• Gene Name: KIR3DL2 killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 2 [ Homo sapiens (human) ]
• Official Symbol: KIR3DL2
• Synonyms: KIR3DL2; killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 2; killer cell immunoglobulin-like receptor 3DL2; CD158K; cl 5; nkat4; nkat4a; nkat4b; KIR antigen 3DL2; killer Ig receptor; p70 NK receptor CL-5; MHC class I NK cell receptor; CD158 antigen-like family member K; p70 killer cell inhibitory receptor; natural killer-associated transcript 4; natural killer cell inhibitory receptor; p70 natural killer cell receptor clone CL-5; killer cell immunoglobulin-like receptor KIR3DL2; p140; NKAT4; NKAT-4; NKAT4B; MGC125321
• Gene ID: 3812
• mRNA Refseq: NM_001242867
• Protein Refseq: NP_001229796
• MIM: 604947
• UniProt ID: P43630