Recombinant Human KANK1 protein, His-tagged

• Cat.No.: KANK1-784H
• Product Overview: Recombinant Human KANK1 protein(291-467 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 291-467 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• AA Sequence: ISVLQEEKRQLVSQLKNQRAASQINVCGVRKRSYSAGNASQLEQLSRARRSGGELYIDYEEEEMETVEQSTQRIKEFRQLTADMQALEQKIQDSSCEASSELRENGECRSVAVGAEENMNDIVVYHRGSRSCKDAAVGTLVEMRNCGVSVTEAMLGVMTEADKEIELQQQTIESLKE
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: KANK1
• Synonyms: KANK1; KN motif and ankyrin repeat domains 1; ANKRD15, ankyrin repeat domain 15; KN motif and ankyrin repeat domain-containing protein 1; KANK; KIAA0172; kidney ankyrin repeat-containing protein; ankyrin repeat domain-containing protein 15; CPSQ2; ANKRD15; FLJ18161; MGC43128; DKFZp451G231
• Gene ID: 23189
• mRNA Refseq: NM_001256876
• Protein Refseq: NP_001243805
• MIM: 607704
• UniProt ID: Q14678