Recombinant Human KANK1 protein, GST-tagged

Cat.No. : KANK1-783H
Product Overview : Recombinant Human KANK1 protein(291-467 aa), fused with N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 291-467 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
AA Sequence : ISVLQEEKRQLVSQLKNQRAASQINVCGVRKRSYSAGNASQLEQLSRARRSGGELYIDYEEEEMETVEQSTQRIKEFRQLTADMQALEQKIQDSSCEASSELRENGECRSVAVGAEENMNDIVVYHRGSRSCKDAAVGTLVEMRNCGVSVTEAMLGVMTEADKEIELQQQTIESLKE
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Official Symbol KANK1
Synonyms KANK1; KN motif and ankyrin repeat domains 1; ANKRD15, ankyrin repeat domain 15; KN motif and ankyrin repeat domain-containing protein 1; KANK; KIAA0172; kidney ankyrin repeat-containing protein; ankyrin repeat domain-containing protein 15; CPSQ2; ANKRD15; FLJ18161; MGC43128; DKFZp451G231;
Gene ID 23189
mRNA Refseq NM_001256876
Protein Refseq NP_001243805
MIM 607704
UniProt ID Q14678

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All KANK1 Products

Required fields are marked with *

My Review for All KANK1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon