Recombinant Human KANK1 protein, GST-tagged
Cat.No. : | KANK1-783H |
Product Overview : | Recombinant Human KANK1 protein(291-467 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 291-467 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | ISVLQEEKRQLVSQLKNQRAASQINVCGVRKRSYSAGNASQLEQLSRARRSGGELYIDYEEEEMETVEQSTQRIKEFRQLTADMQALEQKIQDSSCEASSELRENGECRSVAVGAEENMNDIVVYHRGSRSCKDAAVGTLVEMRNCGVSVTEAMLGVMTEADKEIELQQQTIESLKE |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | KANK1 |
Synonyms | KANK1; KN motif and ankyrin repeat domains 1; ANKRD15, ankyrin repeat domain 15; KN motif and ankyrin repeat domain-containing protein 1; KANK; KIAA0172; kidney ankyrin repeat-containing protein; ankyrin repeat domain-containing protein 15; CPSQ2; ANKRD15; FLJ18161; MGC43128; DKFZp451G231; |
Gene ID | 23189 |
mRNA Refseq | NM_001256876 |
Protein Refseq | NP_001243805 |
MIM | 607704 |
UniProt ID | Q14678 |
◆ Recombinant Proteins | ||
KANK1-783H | Recombinant Human KANK1 protein, GST-tagged | +Inquiry |
KANK1-5558C | Recombinant Chicken KANK1 | +Inquiry |
ANKRD15-576H | Recombinant Human ANKRD15 protein, GST-tagged | +Inquiry |
KANK1-784H | Recombinant Human KANK1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KANK1 Products
Required fields are marked with *
My Review for All KANK1 Products
Required fields are marked with *
0
Inquiry Basket