Recombinant Human ANKRD15 protein, GST-tagged
Cat.No. : | ANKRD15-576H |
Product Overview : | Human ANKRD15 partial ORF ( AAH38116, 701 a.a. - 800 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene belongs to the Kank family of proteins, which contain multiple ankyrin repeat domains. This family member functions in cytoskeleton formation by regulating actin polymerization. This gene is a candidate tumor suppressor for renal cell carcinoma. Mutations in this gene cause cerebral palsy spastic quadriplegic type 2, a central nervous system development disorder. A t(5;9) translocation results in fusion of the platelet-derived growth factor receptor beta gene (PDGFRB) on chromosome 5 with this gene in a myeloproliferative neoplasm featuring severe thrombocythemia. Alternative splicing of this gene results in multiple transcript variants. A related pseudogene has been identified on chromosome 20. [provided by RefSeq, Dec 2014] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | MGSLNSQLISTLSSINSVMKSASTEELRNPDFQKTSLGKITGNYLGYTCKCGGLQSGSPLSSQTSQPEQEVGTSEGKPISSLDAFPTQEGTLSPVNLTDD |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | KANK1 KN motif and ankyrin repeat domains 1 [ Homo sapiens (human) ] |
Official Symbol | KANK1 |
Synonyms | KANK1; KN motif and ankyrin repeat domains 1; KANK; CPSQ2; ANKRD15; KN motif and ankyrin repeat domain-containing protein 1; ankyrin repeat domain-containing protein 15; kidney ankyrin repeat-containing protein |
Gene ID | 23189 |
mRNA Refseq | NM_001256876 |
Protein Refseq | NP_001243805 |
MIM | 607704 |
UniProt ID | Q14678 |
◆ Recombinant Proteins | ||
ANKRD15-576H | Recombinant Human ANKRD15 protein, GST-tagged | +Inquiry |
KANK1-784H | Recombinant Human KANK1 protein, His-tagged | +Inquiry |
KANK1-783H | Recombinant Human KANK1 protein, GST-tagged | +Inquiry |
KANK1-5558C | Recombinant Chicken KANK1 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KANK1 Products
Required fields are marked with *
My Review for All KANK1 Products
Required fields are marked with *
0
Inquiry Basket