Recombinant Human ITSN1 Protein, N-6×His-ABP tagged

• Cat.No.: ITSN1-13H
• Product Overview: A recombinant protein antigen with a N-terminal 6×His-ABP tag corresponding to human ITSN1.

Specification

• Species: Human
• Source: E.coli
• Tag: N-6×His-ABP
• Description: The protein encoded by this gene is a cytoplasmic membrane-associated protein that indirectly coordinates endocytic membrane traffic with the actin assembly machinery. In addition, the encoded protein may regulate the formation of clathrin-coated vesicles and could be involved in synaptic vesicle recycling. This protein has been shown to interact with dynamin, CDC42, SNAP23, SNAP25, SPIN90, EPS15, EPN1, EPN2, and STN2. Multiple transcript variants encoding different isoforms have been found for this gene, but the full-length nature of only two of them have been characterized so far.
• Tag: N-6×His-ABP
• Molecular Mass: 29 kDa.
  
• AA Sequence: ITVLEQQDMWWFGEVQGQKGWFPKSYVKLISGPIRKSTSMDSGSSESPASLKRVASPAAKPVVSGEEFIAMYTYESSEQGDLTFQQGDVILVTKKDGDWW
• Purity: >80% by SDS-PAGE and Coomassie blue staining
• Applications: Antibody Competition
• Dilutions: Antibody Competition 10 - 100 molar excess
• Storage: Store at -20 centigrade. Avoid freeze-thaw cycles.
• Storage Buffer: PBS and 1M Urea, pH 7.4. No Preservative.

Gene Information

• Gene Name: ITSN1 intersectin 1 [ Homo sapiens (human) ]
• Official Symbol: ITSN1
• Synonyms: ITSN1; intersectin 1; ITSN; SH3D1A; SH3P17; intersectin-1; SH3 domain-containing protein 1A; Src homology 3 domain-containing protein; human intersectin-SH3 domain-containing protein SH3P17; intersectin 1 (SH3 domain protein)
• Gene ID: 6453
• mRNA Refseq: NM_003024
• Protein Refseq: NP_003015
• MIM: 602442
• UniProt ID: Q15811