Recombinant Human ITSN1, His-tagged

Cat.No. : ITSN1-28347TH
Product Overview : Recombinant fragment, corresponding to amino acids 876-1232 of Human Intersectin 1 with N terminal His tag; Predicted MWt 40 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 876-1232 a.a.
Description : The protein encoded by this gene is a cytoplasmic membrane-associated protein that indirectly coordinates endocytic membrane traffic with the actin assembly machinery. In addition, the encoded protein may regulate the formation of clathrin-coated vesicles and could be involved in synaptic vesicle recycling. This protein has been shown to interact with dynamin, CDC42, SNAP23, SNAP25, SPIN90, EPS15, EPN1, EPN2, and STN2. Multiple transcript variants encoding different isoforms have been found for this gene, but the full-length nature of only two of them have been characterized so far.
Conjugation : HIS
Tissue specificity : Isoform 2 is ubiquitous in adult and fetal tissues with high expression in skeletal muscle, heart, spleen, ovary, testis and all fetal tissues tested and low expression in thymus, blood, lung, liver and pancreas. Isoform 1 is expressed almost exclusively
Form : Lyophilised:Reconstitute with 148 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QPSLTVPSAGQLRQRSAFTPATATGSSPSPVLGQGEKVEG LQAQALYPWRAKKDNHLNFNKNDVITVLEQQDMWWFGE VQGQKGWFPKSYVKLISGPIRKSTSMDSGSSESPASLK RVASPAAKPVVSGEEFIAMYTYESSEQGDLTFQQGDVI LVTKKDGDWWTGTVGDKAGVFPSNYVRLKDSEGSGTAGKT GSLGKKPEIAQVIASYTATGPEQLTLAPGQLILIRKKN PGGWWEGELQARGKKRQIGWFPANYVKLLSPGTSKITP TEPPKSTALAAVCQVIGMYDYTAQNDDELAFNKGQIIN VLNKEDPDWWKGEVNGQVGLFPSNYVKLTTDMDPSQQW CSDLHLLDMLT
Sequence Similarities : Contains 1 C2 domain.Contains 1 DH (DBL-homology) domain.Contains 2 EF-hand domains.Contains 2 EH domains.Contains 1 PH domain.Contains 5 SH3 domains.
Gene Name ITSN1 intersectin 1 (SH3 domain protein) [ Homo sapiens ]
Official Symbol ITSN1
Synonyms ITSN1; intersectin 1 (SH3 domain protein); ITSN, SH3D1A; intersectin-1; human intersectin SH3 domain containing protein SH3P17; intersectin 1 short form variant 3; intersectin 1 short form variant; 11; intersectin short variant 12; MGC134948; MGC134949; S
Gene ID 6453
mRNA Refseq NM_001001132
Protein Refseq NP_001001132
MIM 602442
Uniprot ID Q15811
Chromosome Location 21q22.1-q22.2
Pathway Cell death signalling via NRAGE, NRIF and NADE, organism-specific biosystem; EPHB forward signaling, organism-specific biosystem; G alpha (12/13) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; Internalization of ErbB1, organism-specific biosystem;
Function Rho guanyl-nucleotide exchange factor activity; calcium ion binding; guanyl-nucleotide exchange factor activity; kinase activator activity; proline-rich region binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ITSN1 Products

Required fields are marked with *

My Review for All ITSN1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon