Recombinant Human ITPR1 Protein, GST-tagged

• Cat.No.: ITPR1-4945H
• Product Overview: Human ITPR1 partial ORF ( NP_002213, 2470 a.a. - 2577 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes an intracellular receptor for inositol 1,4,5-trisphosphate. Upon stimulation by inositol 1,4,5-trisphosphate, this receptor mediates calcium release from the endoplasmic reticulum. Mutations in this gene cause spinocerebellar ataxia type 15, a disease associated with an heterogeneous group of cerebellar disorders. Multiple transcript variants have been identified for this gene. [provided by RefSeq, Nov 2009]
• Molecular Mass: 37.62 kDa
• AA Sequence: EHTCETLLMCIVTVLSHGLRSGGGVGDVLRKPSKEEPLFAARVIYDLLFFFMVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVTFEEHI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ITPR1 inositol 1,4,5-trisphosphate receptor, type 1 [ Homo sapiens ]
• Official Symbol: ITPR1
• Synonyms: ITPR1; inositol 1,4,5-trisphosphate receptor, type 1; SCA15, SCA16, spinocerebellar ataxia 15 , spinocerebellar ataxia 16; inositol 1,4,5-trisphosphate receptor type 1; Insp3r1; IP3R1; IP3R 1; IP3 receptor; type 1 InsP3 receptor; inositol 1,4,5-triphosphate receptor, type 1; type 1 inositol 1,4,5-trisphosphate receptor; IP3R; SCA15; SCA16; INSP3R1; DKFZp313E1334; DKFZp313N1434
• Gene ID: 3708
• mRNA Refseq: NM_001099952
• Protein Refseq: NP_001093422
• MIM: 147265
• UniProt ID: Q14643