Recombinant Human ITGB3BP Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ITGB3BP-3126H
• Product Overview: ITGB3BP MS Standard C13 and N15-labeled recombinant protein (NP_055103) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: This gene encodes a transcriptional coregulator that binds to and enhances the activity of members of the nuclear receptor families, thyroid hormone receptors and retinoid X receptors. This protein also acts as a corepressor of NF-kappaB-dependent signaling. This protein induces apoptosis in breast cancer cells through a caspase 2-mediated signaling pathway. This protein is also a component of the centromere-specific histone H3 variant nucleosome associated complex (CENP-NAC) and may be involved in mitotic progression by recruiting the histone H3 variant CENP-A to the centromere. Alternate splicing results in multiple transcript variants.
• Molecular Mass: 20.2 kDa
• AA Sequence: MPVKRSLKLDGLLEENSFDPSKITRKKSVITYSPTTGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDEFMMLLSKVEKLSEEIMEIMQNLSSIQALEGSRELENLIGISCASHFLKREMQKTKELMTKVNKQKLFEKSTGLPHKASRHLDSYEFLKAILNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ITGB3BP integrin subunit beta 3 binding protein [ Homo sapiens (human) ]
• Official Symbol: ITGB3BP
• Synonyms: ITGB3BP; integrin beta 3 binding protein (beta3-endonexin); centromere protein R; CENPR; HSU37139; NRIF3; TAP20; beta 3 endonexin; beta-3-endonexin; integrin beta-3-binding protein; nuclear receptor-interacting factor 3; CENP-R
• Gene ID: 23421
• mRNA Refseq: NM_014288
• Protein Refseq: NP_055103
• MIM: 605494
• UniProt ID: Q13352