Recombinant Human ITGB3BP Protein, GST-tagged

• Cat.No.: ITGB3BP-4975H
• Product Overview: Human ITGB3BP full-length ORF ( NP_055103.3, 1 a.a. - 177 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a transcriptional coregulator that binds to and enhances the activity of members of the nuclear receptor families, thyroid hormone receptors and retinoid X receptors. This protein also acts as a corepressor of NF-kappaB-dependent signaling. This protein induces apoptosis in breast cancer cells through a caspase 2-mediated signaling pathway. This protein is also a component of the centromere-specific histone H3 variant nucleosome associated complex (CENP-NAC) and may be involved in mitotic progression by recruiting the histone H3 variant CENP-A to the centromere. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2011]
• Molecular Mass: 46.6 kDa
• AA Sequence: MPVKRSLKLDGLLEENSFDPSKITRKKSVITYSPTTGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDEFMMLLSKVEKLSEEIMEIMQNLSSIQALEGSRELENLIGISCASHFLKREMQKTKELMTKVNKQKLFEKSTGLPHKASRHLDSYEFLKAILN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ITGB3BP integrin beta 3 binding protein (beta3-endonexin) [ Homo sapiens ]
• Official Symbol: ITGB3BP
• Synonyms: ITGB3BP; integrin beta 3 binding protein (beta3-endonexin); centromere protein R; CENPR; HSU37139; NRIF3; TAP20; beta 3 endonexin; beta-3-endonexin; integrin beta-3-binding protein; nuclear receptor-interacting factor 3; CENP-R
• Gene ID: 23421
• mRNA Refseq: NM_001206739
• Protein Refseq: NP_001193668
• MIM: 605494
• UniProt ID: Q13352