Recombinant Human ITGB2

• Cat.No.: ITGB2-26325TH
• Product Overview: Recombinant fragment of Human CD18 protein with an N terminal proprietary tag; predicted mwt: 36.63 kDa inclusive of tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• ProteinLength: 100 amino acids
• Description: The product of this gene belongs to the integrin beta chain family of proteins. Integrins are integral cell-surface proteins composed of an alpha chain and a beta chain. This gene encodes the integrin beta chain beta 2. A given chain may combine with multiple partners resulting in different integrins. For example, beta 2 combines with the alpha L chain to form the integrin LFA-1, and combines with the alpha M chain to form the integrin Mac-1. Integrins are known to participate in cell adhesion as well as cell-surface mediated signalling. Defects in this gene are the cause of leukocyte adhesion deficiency type I (LAD1). Two transcript variants encoding the same protein have been identified for this gene.
• Molecular Weight: 36.630kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: VCECHSGYQLPLCQECPGCPSPCGKYISCAECLKFEKGPFGKNCSAACPGLQLSNNPVKGRTCKERDSEGCWVAYTLEQQDGMDRYLIYVDESRECVAGP
• Sequence Similarities: Belongs to the integrin beta chain family.Contains 1 VWFA domain.

Gene Information

• Gene Name: ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) [ Homo sapiens ]
• Official Symbol: ITGB2
• Synonyms: ITGB2; integrin, beta 2 (complement component 3 receptor 3 and 4 subunit); CD18, integrin, beta 2 (antigen CD18 (p95), lymphocyte function associated antigen 1; macrophage antigen 1 (mac 1) beta subunit) , MFI7; integrin beta-2; LFA 1; MAC 1
• Gene ID: 3689
• mRNA Refseq: NM_000211
• Protein Refseq: NP_000202
• MIM: 600065
• Uniprot ID: P05107
• Chromosome Location: 21q22.3
• Pathway: Adaptive Immune System, organism-specific biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; CXCR3-mediated signaling events, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem
• Function: binding; glycoprotein binding; protein kinase binding; receptor activity