Active Recombinant Full Length Human ITGB2 Protein, C-Flag-tagged
Cat.No. : | ITGB2-248HFL |
Product Overview : | Recombinant Full Length Human ITGB2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes an integrin beta chain, which combines with multiple different alpha chains to form different integrin heterodimers. Integrins are integral cell-surface proteins that participate in cell adhesion as well as cell-surface mediated signalling. The encoded protein plays an important role in immune response and defects in this gene cause leukocyte adhesion deficiency. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Far-Western blot ELISA binding assay |
Molecular Mass : | 82.5 kDa |
AA Sequence : | MLGLRPPLLALVGLLSLGCVLSQECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLM RGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSML DDLRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFVNTHPDKLRNPCPNKEKECQPPFAFRHVLKL TNNSNQFQTEVGKQLISGNLDAPEGGLDAMMQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILT PNDGRCHLEDNLYKRSNEFDYPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSS NVVQLIKNAYNKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATEC IQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNCECQTQGRSS QELEGSCRKDNNSIICSGLGDCVCGQCLCHTSDVPGKLIYGQYCECDTINCERYNGQVCGGPGRGLCFCG KCRCHPGFEGSACQCERTTEGCLNPRRVECSGRGRCRCNVCECHSGYQLPLCQECPGCPSPCGKYISCAE CLKFEKGPFGKNCSAACPGLQLSNNPVKGRTCKERDSEGCWVAYTLEQQDGMDRYLIYVDESRECVAGPN IAAIVGGTVAGIVLIGILLLVIWKALIHLSDLREYRRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAESTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Protein Pathways : | Cell adhesion molecules (CAMs), Leukocyte transendothelial migration, Natural killer cell mediated cytotoxicity, Regulation of actin cytoskeleton, Viral myocarditis |
Full Length : | Full L. |
Gene Name | ITGB2 integrin subunit beta 2 [ Homo sapiens (human) ] |
Official Symbol | ITGB2 |
Synonyms | LAD; CD18; MF17; MFI7; LCAMB; LFA-1; MAC-1 |
Gene ID | 3689 |
mRNA Refseq | NM_001127491.3 |
Protein Refseq | NP_001120963.2 |
MIM | 600065 |
UniProt ID | P05107 |
◆ Native Proteins | ||
F2-73R | Native Rat Prothrombin | +Inquiry |
a-Thrombin-97H | Native Human a-Thrombin | +Inquiry |
Acetate Kinase-22B | Active Native Bacillus stearothermophilus Acetate Kinase | +Inquiry |
RPE-426 | Native RPE | +Inquiry |
IBVF0704-224I | Native Influenza (B/Florida 07/04 ) IBVF0704 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TBL3-1211HCL | Recombinant Human TBL3 293 Cell Lysate | +Inquiry |
RDH11-2438HCL | Recombinant Human RDH11 293 Cell Lysate | +Inquiry |
FAM171B-783HCL | Recombinant Human FAM171B cell lysate | +Inquiry |
NDUFS8-3892HCL | Recombinant Human NDUFS8 293 Cell Lysate | +Inquiry |
ZMYND10-152HCL | Recombinant Human ZMYND10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ITGB2 Products
Required fields are marked with *
My Review for All ITGB2 Products
Required fields are marked with *
0
Inquiry Basket