Recombinant Human ITGAX Protein, GST-tagged

• Cat.No.: ITGAX-4987H
• Product Overview: Human ITGAX partial ORF ( NP_000878, 114 a.a. - 223 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes the integrin alpha X chain protein. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This protein combines with the beta 2 chain (ITGB2) to form a leukocyte-specific integrin referred to as inactivated-C3b (iC3b) receptor 4 (CR4). The alpha X beta 2 complex seems to overlap the properties of the alpha M beta 2 integrin in the adherence of neutrophils and monocytes to stimulated endothelium cells, and in the phagocytosis of complement coated particles. [provided by RefSeq
• Molecular Mass: 37.84 kDa
• AA Sequence: HECGRNMYLTGLCFLLGPTQLTQRLPVSRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQFQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPLSLLASVHQLQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ITGAX integrin, alpha X (complement component 3 receptor 4 subunit) [ Homo sapiens ]
• Official Symbol: ITGAX
• Synonyms: ITGAX; integrin, alpha X (complement component 3 receptor 4 subunit); CD11C, integrin, alpha X (antigen CD11C (p150), alpha polypeptide); integrin alpha-X; CD11c; leu M5, alpha subunit; p150 95 integrin alpha chain; CD11 antigen-like family member C; leukocyte adhesion receptor p150,95; myeloid membrane antigen, alpha subunit; leukocyte surface antigen p150,95, alpha subunit; leukocyte adhesion glycoprotein p150,95 alpha chain; integrin, alpha X (antigen CD11C (p150), alpha polypeptide); CD11C; SLEB6
• Gene ID: 3687
• mRNA Refseq: NM_000887
• Protein Refseq: NP_000878
• MIM: 151510
• UniProt ID: P20702