Recombinant Human ITGAX protein, His-tagged

• Cat.No.: ITGAX-183H
• Product Overview: Recombinant Human ITGAX protein(NP_000878)(21-352 aa), fused with His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
• Protein length: 21-352 aa
• AA Sequence: NLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAANQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNMYLTGLCFLLGPTQLTQRLPVSRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQFQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPLSLLASVHQLQGFTYTATAIQNVVHRLFHASYGARRDAAKILIVITDGKKEGDSLDYKDVIPMADAAGIIRYAIGVGLAFQNRNSWKELNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELEMA
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: ITGAX integrin, alpha X (complement component 3 receptor 4 subunit) [ Homo sapiens ]
• Official Symbol: ITGAX
• Synonyms: ITGAX; integrin, alpha X (complement component 3 receptor 4 subunit); CD11C, integrin, alpha X (antigen CD11C (p150), alpha polypeptide); integrin alpha-X; CD11c; leu M5, alpha subunit; p150 95 integrin alpha chain; CD11 antigen-like family member C; leukocyte adhesion receptor p150,95; myeloid membrane antigen, alpha subunit; leukocyte surface antigen p150,95, alpha subunit; leukocyte adhesion glycoprotein p150,95 alpha chain; integrin, alpha X (antigen CD11C (p150), alpha polypeptide); CD11C; SLEB6
• Gene ID: 3687
• mRNA Refseq: NM_000887
• Protein Refseq: NP_000878
• MIM: 151510
• UniProt ID: P20702