Recombinant Human ITGA7 Protein, GST-tagged
Cat.No. : | ITGA7-4994H |
Product Overview : | Human ITGA7 partial ORF ( NP_002197, 478 a.a. - 577 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. They mediate a wide spectrum of cell-cell and cell-matrix interactions, and thus play a role in cell migration, morphologic development, differentiation, and metastasis. This protein functions as a receptor for the basement membrane protein laminin-1. It is mainly expressed in skeletal and cardiac muscles and may be involved in differentiation and migration processes during myogenesis. Defects in this gene are associated with congenital myopathy. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq |
Molecular Mass : | 36.74 kDa |
AA Sequence : | SHEVSIAPRSIDLEQPNCAGGHSVCVDLRVCFSYIAVPSSYSPTVALDYVLDADTDRRLRGQVPRVTFLSRNLEEPKHQASGTVWLKHQHDRVCGDAMFQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ITGA7 integrin, alpha 7 [ Homo sapiens ] |
Official Symbol | ITGA7 |
Synonyms | ITGA7; integrin, alpha 7; integrin alpha-7; integrin alpha 7 chain; FLJ25220; |
Gene ID | 3679 |
mRNA Refseq | NM_001144996 |
Protein Refseq | NP_001138468 |
MIM | 600536 |
UniProt ID | Q13683 |
◆ Recombinant Proteins | ||
ITGA7-4994H | Recombinant Human ITGA7 Protein, GST-tagged | +Inquiry |
ITGA7-2768R | Recombinant Rat ITGA7 Protein, His (Fc)-Avi-tagged | +Inquiry |
ITGA7-4995H | Recombinant Human ITGA7 Protein, His-tagged | +Inquiry |
ITGA7-28842TH | Recombinant Human ITGA7 | +Inquiry |
ITGA7-3112R | Recombinant Rat ITGA7 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ITGA7 Products
Required fields are marked with *
My Review for All ITGA7 Products
Required fields are marked with *
0
Inquiry Basket