Recombinant Human ITGA7
Cat.No. : | ITGA7-28842TH |
Product Overview : | Recombinant fragment corresponding to amino acids 478-577 of Human ITGA7 with N terminal proprietary tag; predicted MWt 36.63 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | The protein encoded by this gene belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. They mediate a wide spectrum of cell-cell and cell-matrix interactions, and thus play a role in cell migration, morphologic development, differentiation, and metastasis. This protein functions as a receptor for the basement membrane protein laminin-1. It is mainly expressed in skeletal and cardiac muscles and may be involved in differentiation and migration processes during myogenesis. Defects in this gene are associated with congenital myopathy. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Isoforms containing segment A are predominantly expressed in skeletal muscle. Isoforms containing segment B are abundantly expressed in skeletal muscle, moderately in cardiac muscle, small intestine, colon, ovary and prostate and weakly in lung and testes |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SHEVSIAPRSIDLEQPNCAGGHSVCVDLRVCFSYIAVPSSYSPTVALDYVLDADTDRRLRGQVPRVTFLSRNLEEPKHQASGTVWLKHQHDRVCGDAMFQ |
Sequence Similarities : | Belongs to the integrin alpha chain family.Contains 7 FG-GAP repeats. |
Gene Name | ITGA7 integrin, alpha 7 [ Homo sapiens ] |
Official Symbol | ITGA7 |
Synonyms | ITGA7; integrin, alpha 7; integrin alpha-7; |
Gene ID | 3679 |
mRNA Refseq | NM_001144996 |
Protein Refseq | NP_001138468 |
MIM | 600536 |
Uniprot ID | Q13683 |
Chromosome Location | 12q13 |
Pathway | Arrhythmogenic right ventricular cardiomyopathy (ARVC), organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), conserved biosystem; Dilated cardiomyopathy, organism-specific biosystem; Dilated cardiomyopathy, conserved biosystem; ECM-receptor interaction, organism-specific biosystem; |
Function | receptor activity; |
◆ Recombinant Proteins | ||
ITGA7-4994H | Recombinant Human ITGA7 Protein, GST-tagged | +Inquiry |
ITGA7-4995H | Recombinant Human ITGA7 Protein, His-tagged | +Inquiry |
ITGA7-2768R | Recombinant Rat ITGA7 Protein, His (Fc)-Avi-tagged | +Inquiry |
ITGA7-28842TH | Recombinant Human ITGA7 | +Inquiry |
ITGA7-3112R | Recombinant Rat ITGA7 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ITGA7 Products
Required fields are marked with *
My Review for All ITGA7 Products
Required fields are marked with *
0
Inquiry Basket