Recombinant Human ITGA2B Protein, GST-tagged

• Cat.No.: ITGA2B-4999H
• Product Overview: Human ITGA2B partial ORF (NP_000410.2, 504 a.a. - 602 a.a.) recombinant protein with GST tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 504-602 a.a.
• Description: ITGA2B encodes integrin alpha chain 2b. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. Alpha chain 2b undergoes post-translational cleavage to yield disulfide-linked light and heavy chains that join with beta 3 to form a fibronectin receptor expressed in platelets that plays a crucial role in coagulation. Mutations that interfere with this role result in thrombasthenia. In addition to adhesion, integrins are known to participate in cell-surface mediated signalling. [provided by RefSeq
• Molecular Mass: 36.63 kDa
• AA Sequence: CVLPQTKTPVSCFNIQMCVGATGHNIPQKLSLNAELQLDRQKPRQGRRVLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDEADFRDKLSPIVLSLNV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ITGA2B integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41) [ Homo sapiens ]
• Official Symbol: ITGA2B
• Synonyms: ITGA2B; integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41); GP2B, integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41B); integrin alpha-IIb; CD41; CD41B; GPalpha IIb; platelet-specific antigen BAK; platelet membrane glycoprotein IIb; platelet fibrinogen receptor, alpha subunit; GT; GTA; GP2B; HPA3; GPIIb; BDPLT2
• Gene ID: 3674
• mRNA Refseq: NM_000419
• Protein Refseq: NP_000410
• MIM: 607759
• UniProt ID: P08514