Recombinant Human ITGA2B protein(751-820 aa), C-hFc & C-His-tagged

• Cat.No.: ITGA2B-2598H
• Product Overview: Recombinant Human ITGA2B protein(P08514)(751-820 aa), fused with C-terminal hFc and C-terminal His tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: Fc&His
• Protein Length: 751-820 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: QLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNN

Gene Information

• Gene Name: ITGA2B integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41) [ Homo sapiens ]
• Official Symbol: ITGA2B
• Synonyms: ITGA2B; integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41); GP2B, integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41B); integrin alpha-IIb; CD41; CD41B; GPalpha IIb; platelet-specific antigen BAK; platelet membrane glycoprotein IIb; platelet fibrinogen receptor, alpha subunit; GT; GTA; GP2B; HPA3; GPIIb; BDPLT2
• Gene ID: 3674
• mRNA Refseq: NM_000419
• Protein Refseq: NP_000410
• MIM: 607759
• UniProt ID: P08514