Recombinant Human ITGA2B protein, His-SUMO-tagged

• Cat.No.: ITGA2B-3124H
• Product Overview: Recombinant Human ITGA2B protein(P08514)(639-887aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• ProteinLength: 639-887aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 43 kDa
• AA Sequence: CVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRVVLCELGNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQPSDLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPIPSPSPIHPAHHKR
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: ITGA2B integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41) [ Homo sapiens ]
• Official Symbol: ITGA2B
• Synonyms: ITGA2B; integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41); GP2B, integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41B); integrin alpha-IIb; CD41; CD41B; GPalpha IIb; platelet-specific antigen BAK; platelet membrane glycoprotein IIb; platelet fibrinogen receptor, alpha subunit; GT; GTA; GP2B; HPA3; GPIIb; BDPLT2
• Gene ID: 3674
• mRNA Refseq: NM_000419
• Protein Refseq: NP_000410
• MIM: 607759
• UniProt ID: P08514