Recombinant Human ISG20 protein, GST-tagged
Cat.No. : | ISG20-508H |
Product Overview : | Recombinant Human ISG20 protein(NP_002192)(1-150 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Source : | E. coli |
Species : | Human |
Tag : | GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
Protein length : | 1-150 aa |
AA Sequence : | MAGSREVVAMDCEMVGLGPHRESGLARCSLVNVHGAVLYDKFIRPEGEITDYRTRVSGVTPQHMVGATPFAVARLEILQLLKGKLVVGHDLKHDFQALKEDMSGYTIYDTSTDRLLWREAKLDHCRRVSLRVLSERLLHKSIQNSLLGHS |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). |
Gene Name | ISG20 interferon stimulated exonuclease gene 20kDa [ Homo sapiens ] |
Official Symbol | ISG20 |
Synonyms | ISG20; interferon stimulated exonuclease gene 20kDa; interferon stimulated gene (20kD); interferon-stimulated gene 20 kDa protein; CD25; HEM45; estrogen-regulated transcript 45 protein; promyelocytic leukemia nuclear body-associated protein ISG20; |
Gene ID | 3669 |
mRNA Refseq | NM_002201 |
Protein Refseq | NP_002192 |
MIM | 604533 |
UniProt ID | Q96AZ6 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ISG20 Products
Required fields are marked with *
My Review for All ISG20 Products
Required fields are marked with *
0
Inquiry Basket