Recombinant Full Length Human ISG20 Protein, C-Flag-tagged

• Cat.No.: ISG20-1682HFL
• Product Overview: Recombinant Full Length Human ISG20 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Description: Enables 3'-5' exonuclease activity and RNA binding activity. Involved in defense response to virus; negative regulation of viral genome replication; and nucleobase-containing compound catabolic process. Located in cytoplasm and nuclear lumen.
• Source: Mammalian cells
• Species: Human
• Tag: Flag
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 20.2 kDa
• AA Sequence: MAGSREVVAMDCEMVGLGPHRESGLARCSLVNVHGAVLYDKFIRPEGEITDYRTRVSGVTPQHMVGATPF AVARLEILQLLKGKLVVGHDLKHDFQALKEDMSGYTIYDTSTDRLLWREAKLDHCRRVSLRVLSERLLHK
  SIQNSLLGHSSVEDARATMELYQISQRIRARRGLPRLAVSDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Full Length: Full L.

Gene Information

• Gene Name: ISG20 interferon stimulated exonuclease gene 20 [ Homo sapiens (human) ]
• Official Symbol: ISG20
• Synonyms: CD25; HEM45
• Gene ID: 3669
• mRNA Refseq: NM_002201.6
• Protein Refseq: NP_002192.2
• MIM: 604533
• UniProt ID: Q96AZ6