Recombinant Full Length Human ISG20 Protein, C-Flag-tagged

Cat.No. : ISG20-1682HFL
Product Overview : Recombinant Full Length Human ISG20 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Enables 3'-5' exonuclease activity and RNA binding activity. Involved in defense response to virus; negative regulation of viral genome replication; and nucleobase-containing compound catabolic process. Located in cytoplasm and nuclear lumen.
Source : Mammalian cells
Species : Human
Tag : Flag
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 20.2 kDa
AA Sequence : MAGSREVVAMDCEMVGLGPHRESGLARCSLVNVHGAVLYDKFIRPEGEITDYRTRVSGVTPQHMVGATPF AVARLEILQLLKGKLVVGHDLKHDFQALKEDMSGYTIYDTSTDRLLWREAKLDHCRRVSLRVLSERLLHK
SIQNSLLGHSSVEDARATMELYQISQRIRARRGLPRLAVSDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Full Length : Full L.
Gene Name ISG20 interferon stimulated exonuclease gene 20 [ Homo sapiens (human) ]
Official Symbol ISG20
Synonyms CD25; HEM45
Gene ID 3669
mRNA Refseq NM_002201.6
Protein Refseq NP_002192.2
MIM 604533
UniProt ID Q96AZ6

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ISG20 Products

Required fields are marked with *

My Review for All ISG20 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon