Recombinant Human INTS6 Protein, GST-tagged

• Cat.No.: INTS6-2479H
• Product Overview: Human DDX26 partial ORF ( NP_036273, 779 a.a. - 887 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. The protein encoded by this gene is a DEAD box protein that is part of a complex that interacts with the C-terminus of RNA polymerase II and is involved in 3' end processing of snRNAs. In addition, this gene is a candidate tumor suppressor and is located in the critical region of loss of heterozygosity (LOH). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2015]
• Molecular Mass: 37.73 kDa
• AA Sequence: DKEQCAEENIPASSLNKGKKLMHCRSHEEVNTELKAQIMKEIRKPGRKYERIFTLLKHVQGSLQTRLIFLQNVIKEASRFKKRMLIEQLENFLDEIHRRANQINHINSN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: INTS6 integrator complex subunit 6 [ Homo sapiens ]
• Official Symbol: INTS6
• Synonyms: INTS6; integrator complex subunit 6; DDX26, DEAD/H (Asp Glu Ala Asp/His) box polypeptide 26; DBI 1; DDX26A; DICE1; HDB; INT6; Notchl2; DEAD box protein; RNA helicase HDB; protein deleted in cancer 1; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 26; DBI-1; DDX26; DKFZp434B105
• Gene ID: 26512
• mRNA Refseq: NM_001039937
• Protein Refseq: NP_001035026
• MIM: 604331
• UniProt ID: Q9UL03