Recombinant Human IL7 Protein, His-tagged

• Cat.No.: IL7-121H
• Product Overview: Recombinant Human Interleukin-7 is produced by our Mammalian expression system and the target gene encoding Asp26-His177 is expressed with a 6His tag at the C-terminus.

Specification

• Species: Human
• Source: Human Cells
• Tag: His
• Protein Length: Asp26-His177
• Description: Human Interleukin 7 (IL-7) is a potent lymphoid cell growth factor stimulating the proliferation of lymphoid progenitors. IL7 can associate with the hepatocyte growth factor (HGF) to form a hybrid cytokine that functions as a pre-pro-B cell growth-stimulating factor. Human IL7 cDNA encodes a 177 amino acid precursor protein containing a 25 amino acid signal peptide and a 152 amino acid mature protein. Human and mouse IL7 share 65% sequence identity in the mature region and both exhibit cross-species activity. IL-7 signals via IL-7 receptor (IL7R) activating multiple pathways including JaK/STAT and PI3K/AKT, which regulate lymphocyte survival, glucose uptake, proliferation, and differentiation. IL-7 is also associated with cytoplasmic IL2-R gamma for signal transduction.
• Form: Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
• AA Sequence: DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFL KMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRL LQEIKTCWNKILMGTKEHVDHHHHHH
• Endotoxin: Less than 0.1 ng/ug (1 EU/ug).
• Purity: >95%
• Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.
  Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days. Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting
• Reconstitution: It is not recommended to reconstitute to a concentration less than 100μg/ml.
  Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• Quality Statement: Greater than 95% as determined by reducing SDS-PAGE.
• Shipping: The product is shipped at ambient temperature.
  Upon receipt, store it immediately at the temperature listed below.

Gene Information

• Gene Name: IL7 interleukin 7 [ Homo sapiens (human) ]
• Official Symbol: IL7
• Synonyms: Interleukin-7; IL-7
• Gene ID: 3574
• mRNA Refseq: NM_000880.4
• Protein Refseq: NP_000871.1
• MIM: 146660
• UniProt ID: P13232