Recombinant Human IL7 Protein, His-tagged
Cat.No. : | IL7-121H |
Product Overview : | Recombinant Human Interleukin-7 is produced by our Mammalian expression system and the target gene encoding Asp26-His177 is expressed with a 6His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | His |
Protein Length : | Asp26-His177 |
Description : | Human Interleukin 7 (IL-7) is a potent lymphoid cell growth factor stimulating the proliferation of lymphoid progenitors. IL7 can associate with the hepatocyte growth factor (HGF) to form a hybrid cytokine that functions as a pre-pro-B cell growth-stimulating factor. Human IL7 cDNA encodes a 177 amino acid precursor protein containing a 25 amino acid signal peptide and a 152 amino acid mature protein. Human and mouse IL7 share 65% sequence identity in the mature region and both exhibit cross-species activity. IL-7 signals via IL-7 receptor (IL7R) activating multiple pathways including JaK/STAT and PI3K/AKT, which regulate lymphocyte survival, glucose uptake, proliferation, and differentiation. IL-7 is also associated with cytoplasmic IL2-R gamma for signal transduction. |
Form : | Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.4. |
AA Sequence : | DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFL KMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRL LQEIKTCWNKILMGTKEHVDHHHHHH |
Endotoxin : | Less than 0.1 ng/ug (1 EU/ug). |
Purity : | >95% |
Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days. Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. Always centrifuge tubes before opening. Do not mix by vortex or pipetting |
Reconstitution : | It is not recommended to reconstitute to a concentration less than 100μg/ml. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Quality Statement : | Greater than 95% as determined by reducing SDS-PAGE. |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature listed below. |
Gene Name | IL7 interleukin 7 [ Homo sapiens (human) ] |
Official Symbol | IL7 |
Synonyms | Interleukin-7; IL-7 |
Gene ID | 3574 |
mRNA Refseq | NM_000880.4 |
Protein Refseq | NP_000871.1 |
MIM | 146660 |
UniProt ID | P13232 |
◆ Recombinant Proteins | ||
IL7-51H | Active Recombinant Human Interleukin 7, MIgG2a Fc-tagged | +Inquiry |
IL7-14210H | Recombinant Human IL7, His-tagged | +Inquiry |
IL7-52H | Active Recombinant Human Interleukin 7, HIgG1 Fc-tagged | +Inquiry |
IL7-9011H | Active Recombinant Human IL7 | +Inquiry |
IL7-056H | Recombinant Human interleukin 7 Protein, His&Flag tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL7-5223HCL | Recombinant Human IL7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL7 Products
Required fields are marked with *
My Review for All IL7 Products
Required fields are marked with *
0
Inquiry Basket