Recombinant Human IL7 protein

• Cat.No.: IL7-64H
• Product Overview: Recombinant Human IL7 protein was expressed in Escherichia coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 152
• Description: Interleukin-7 (IL-7) is encoded by the IL7 gene and secreted by stromal cells in the red marrow and thymus. It binds to the IL-7 receptor, a heterodimer consisting of IL-7 receptor alpha and IL-2 receptor gamma chain. IL-7 stimulates the differentiation of hematopoietic stem cells into lymphoid progenitor cells and also stimulates proliferation of B cells, T cells and NK cells. Murine IL-7 has approximately 65 % amino acid sequence identity with human IL-7 and both proteins exhibit cross-speciesactivity. IL-7 as an immunotherapy agent has been examinedin many human clinical trials for various malignancies and during HIV infection.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine 2E8 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 10⁶ IU/mg.
• Molecular Mass: Approximately 17.4 kDa, a single non-glycosylated polypeptide chain containing 152 amino acids.
• AA Sequence: DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
• Endotoxin: Less than 1 EU/µg of rHuIL-7 as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: IL7
• Official Symbol: IL7
• Synonyms: IL7; interleukin 7; interleukin-7; IL 7; IL-7
• Gene ID: 3574
• mRNA Refseq: NM_000880
• Protein Refseq: NP_000871
• MIM: 146660
• UniProt ID: P13232