Recombinant Human IL24 protein, His-tagged

• Cat.No.: IL24-2978H
• Product Overview: Recombinant Human IL24 protein(53-207 aa), fused to His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Protein length: 53-207 aa
• AA Sequence: QEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: IL24 interleukin 24 [ Homo sapiens ]
• Official Symbol: IL24
• Synonyms: IL24; interleukin 24; ST16; interleukin-24; C49A; FISP; IL 4 induced secreted protein; IL 24; IL10B; mda 7; melanoma differentiation association protein 7; Mob 5; suppression of tumorigenicity 16 (melanoma differentiation); melanocyte-associated Mda-7; IL-4-induced secreted protein; melanoma differentiation-associated gene 7 protein; MDA7; MOB5
• Gene ID: 11009
• mRNA Refseq: NM_001185156
• Protein Refseq: NP_001172085
• MIM: 604136
• UniProt ID: Q13007